KEGG   Rattus norvegicus (rat): 362993
Entry
362993            CDS       T01003                                 

Gene name
Rnd1
Definition
(RefSeq) Rho family GTPase 1
  KO
K07531  Rho family GTPase 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    362993 (Rnd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    362993 (Rnd1)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rho Family
   Rnd [OT]
    362993 (Rnd1)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA PduV-EutP
Other DBs
NCBI-GeneID: 362993
NCBI-ProteinID: NP_001013240
RGD: 1306338
Ensembl: ENSRNOG00000059857
UniProt: Q5FVG9
Position
7q36
AA seq 232 aa
MKERRTPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQR
VELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDYCPSTRV
LLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSETSIHSIF
RTASMVCLNKPSPVPPKSPVRSLSKRLLHLPSRSELITSTFKKEKAKSCSIM
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaggagagacggacaccgcagccagtggtggtcagatgtaagcttgtgctggtgggg
gacgtgcagtgtgggaagacggcgatgttacaggtgctagcgaaagactgctatcccgag
acctatgtgcctaccgtgtttgagaattacacagcctgtttggagacagaggaacagaga
gtggagcttagtctctgggatacctcaggctctccgtactatgacaatgtccgtccactc
tgctacagcgactcggatgcagtgttgctctgcttcgacatcagccgtccagagacgatg
gacagtgcactcaagaagtggagaacagaaatcctagactattgtcccagcacacgtgtt
ttgcttattggctgcaagacagatcttcgaacagacctgagcactctaatggaactgtcc
caccagaagcaggcacccatctcctacgagcagggctgtgcgatagccaagcagttgggt
gcagagatctacctggagggctcagctttcacctcggagacgagcatccacagcatcttc
cggacggcatccatggtgtgtctgaacaagcctagcccagtgcccccgaagagccctgtc
cgaagcctctccaagcgactactccaccttcccagtcgctctgaactcatcacttctacc
ttcaagaaggagaaggccaaaagctgttctatcatgtga

DBGET integrated database retrieval system