KEGG   Rattus norvegicus (rat): 498234
Entry
498234            CDS       T01003                                 

Gene name
Arl8a, RGD1565940
Definition
(RefSeq) ADP-ribosylation factor like GTPase 8A
  KO
K07955  ADP-ribosylation factor-like protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    498234 (Arl8a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    498234 (Arl8a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    498234 (Arl8a)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   Arf GTPases
    498234 (Arl8a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl8
    498234 (Arl8a)
SSDB
Motif
Pfam: Arf Ras Roc Gtr1_RagA SRPRB G-alpha MMR_HSR1
Other DBs
NCBI-GeneID: 498234
NCBI-ProteinID: NP_001102541
RGD: 1565940
Ensembl: ENSRNOG00000005988
UniProt: D3ZPP2
Position
13q13
AA seq 186 aa
MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKI
TKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQL
QGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH
SKSRRS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgatcgctttgttcaacaaactgctggactggttcaaggccctgttctggaaggaggaa
atggagctcacgctggtggggctgcagtactccggcaagaccaccttcgtcaacgtgatc
gcgtcaggacagttcaatgaggacatgatccccaccgtgggcttcaacatgcgcaaaatc
accaaagggaatgtcaccatcaagctctgggacattgggggacagccccgtttccgaagc
atgtgggagcgctactgcagaggagtgagcgccatcgtgtatatggtggatgctgcggac
caggagaagatcgaggcctccaagaatgagctccacaacctgctagacaagccacagctg
caaggcatcccggtcttagtcctcggtaacaagcgagacctcgccggagcgctagatgag
aaggagctaatcgagaaaatgaatctgtccgctatccaggaccgagagatctgctgctac
tccatctcctgcaaggagaaggacaacatagacatcaccctacagtggcttattcaacac
tcaaagtcacggagaagctga

DBGET integrated database retrieval system