KEGG   Rattus norvegicus (rat): 59107
Entry
59107             CDS       T01003                                 

Gene name
Ltbp1
Definition
(RefSeq) latent transforming growth factor beta binding protein 1
  KO
K19559  latent transforming growth factor beta binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    59107 (Ltbp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    59107 (Ltbp1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   59107 (Ltbp1)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF EGF_3 hEGF Plasmod_Pvs28 FXa_inhibition EGF_MSP1_1
Other DBs
NCBI-GeneID: 59107
NCBI-ProteinID: NP_067598
RGD: 68379
Ensembl: ENSRNOG00000033090
UniProt: Q00918
Position
6q13
AA seq 1712 aa
MAGAWLRWGLLLWAGLLAWSAHGRVRRITYVVRPGPGLPAGTLPLAGPPRTFNVALDARY
SRSSTATSSRSLAGPPAERTRRTSQPGGAALPGLRSPLPPEPARPGAPSRQLHSKAGAQT
AVTRFAKHGRQVVRSKVQQDTQSSGGSRLQVQQKQQLQGINVCGGQCCHGWSKAPGSQRC
TKPSCVPPCQNGGMCLRPQFCVCKPGTKGKACEITAAQDTMSPVFGGQNPGSSWVPPEPA
AKRTSTKKADTLPRVSPVAQMTLTLKPKPSMGLSQQIHSQVAPLSSQNVMIRHGQTQEYV
LKPKYFPAPKVVSGEQSTEGSFSLRYGQEQGTAPFQVSNHTGRIKVVFTPSICKVTCTKG
NCHNSCQKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGK
LCQIPVLGASMPKLYQHAQQPGKALGSHVIHSTHTLPLTMTNQQGVKVKFPPNIVNIHVK
HPPEASVQIHQVSRIDGPVGQRVKEVQPGQSQVSYQGLPVQKTQTVHSTYSHQQVIPHVY
PVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKQSYHGYTQ
MMECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSCVPD
PPMISEEKGPCYRLVSPGRQCMHPLSVHLTKQICCCSVGKAWGPQCEKCPLPGTAAFKEI
CPGGMGYTVSGIHRRRPIHQHIGKEAVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTSSR
EHGPGVAEPEVVTAPPEKEIPSLDQEKTRLEPGQPQLSPGVSTIHLHPQFPVVVEKTSPP
VPVEVAPEGSTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYKFSE
QQRKCIDIDECAQAQHLCSQGRCENTEGSFLCICPAGFIASEEGSNCIDVDECLRPDVCR
DGRCINTAGAFRCEYCDSGYRMSRRGHCEDIDECLTPSTCPEEQCVNSPGSYQCVPCTEG
FRGWNGQCLDVDECLQPKVCTNGSCTNLEGSYMCSCHKGYSPTPDHRHCQDIDECQQGNL
CMNGQCKNTDGSFRCTCGQGYQLSAAKDQCEDIDECEHRHLCSHGQCRNTEGSFQCLCNQ
GYRASVLGDHCEDINECLEDSSVCQGGDCINTAGSYDCTCPDGLQLNDNKGCQDINECAQ
PGLCAPHGECLNTQGSFHCVCEQGFSISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFR
CLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCR
SRATEDSGVDRQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPC
PVQGTAEFSEMCPRGKGFVPAGESSYETGGENYKDADECLLFGEEICKNGYCLNTQPGYE
CYCKEGTYYDPVKLQCFDMDECQDPNSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQP
TESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKD
SDDYAQLCNIPVTGRRRPYGRDALVDFSEQYGPETDPYFIQDRFLNSFEELQAEECGILN
GCENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEGSYK
CVCLPGYVPSDKPNYCTPLNTALNLDKDSDLE
NT seq 5139 nt   +upstreamnt  +downstreamnt
atggcgggagcctggctcaggtggggactcctgctctgggcagggctgctagcgtggtct
gcgcacggccgggtgcggaggatcacgtacgtggtgcgcccgggcccgggactgccggcc
ggaaccctgcctctggctgggcccccgcggaccttcaacgtcgcactggacgccaggtac
agccggagctcaacagccacctccagccgctccttggccgggcccccagccgagcggacc
cggcgcaccagccagcctggcggcgcggccctgcccgggctccgatctccgctgccaccc
gagcccgcgcgtccgggggcgcccagccggcagctccactcaaaggccggtgctcagacc
gcggtcactcgcttcgccaaacatggcaggcaagtcgtgcgctccaaagtgcagcaggac
acgcagagctccgggggctccagactgcaggttcagcagaagcagcagctgcaggggatc
aatgtctgtggagggcagtgctgccatgggtggagtaaggccccgggctcccagaggtgc
accaaaccaagctgtgttccaccatgccagaatggagggatgtgtctccggcctcagttc
tgtgtgtgtaagccagggacaaagggcaaagcctgcgagatcacagctgcccaggacacc
atgtcaccagtgtttggagggcagaaccctggctcctcgtgggtccctcctgagccagca
gcaaagcgtacttcaaccaagaaggcagacaccttaccaagggtcagtccagtggcccag
atgaccttgaccctcaagccgaagccgtccatgggactctcccagcagatacattctcaa
gtggcacccttgtcttcccagaatgtgatgattcggcatggccagacccaggagtatgtg
ctcaagcccaagtacttcccagccccaaaggtggtctctggagagcagtccacagaaggc
tctttctctttaagatatgggcaggagcaaggcacagcaccctttcaggtgagtaaccac
actggtcgcatcaaggtggtctttactccgagcatctgtaaagtgacctgcaccaagggc
aactgtcacaacagctgccagaaggggaataccaccactctcattagtgagaacggccat
gcagccgacaccctgacagccacgaacttccgagtggtaatttgccatcttccatgtatg
aatggtggccagtgcagttcaagggacaaatgtcagtgccctccaaatttcacaggaaag
ctttgccagatccctgtccttggtgccagtatgcctaaactctaccagcacgcccagcag
ccaggcaaggcactggggagtcacgtcatccattccacacataccttgcctctaaccatg
accaaccagcaaggggtcaaagtgaaatttccccccaacatagtcaatatccatgtgaag
catcctcctgaggcttctgtgcagatacaccaggtttccagaattgatggcccagtgggc
cagagggtgaaagaagtgcaaccgggccagtcccaagtctcttaccaagggctgcccgtc
cagaagacccagacagtccattccacatactcccaccagcaggtcattccgcatgtgtat
cccgtggctgctaagacacaacttggacgatgcttccaggaaaccattgggtcacagtgt
ggcaaagcgctccctggcctttcaaagcaagaggactgctgtgggacagtggggacctcc
tggggctttaacaaatgccagaaatgccccaagaagcaatcctatcatggatatactcaa
atgatggaatgcctacaaggatataaacgggttaacaacaccttttgtcaagatattaat
gaatgtcagctccaaggcgtatgccctaatggggagtgtttgaataccatgggcagctac
agatgctcctgcaaaatgggatttgggcctgaccctaccttttcaagttgtgtgccggat
ccccctatgatctcagaagagaaagggccctgctaccgcctcgtcagtcctgggaggcag
tgtatgcaccctctctctgttcacctcaccaagcagatctgctgttgtagtgtgggcaag
gcctggggcccacagtgtgagaaatgtcccctcccgggcacagctgcttttaaggaaatc
tgtcctggtggaatgggttatacggtttctggcattcatagacgcaggccaatccatcag
catataggtaaagaagctgtatttgtcaagccaaagaacactcaacctgttgctaaaagt
actcatcctccacctctcccagccaaggaagagcctgtggaggccctgacctcctcgcgg
gaacatgggccgggagtggcagagcctgaagtggtaacagcacctcctgagaaggaaata
ccctcactggatcaagagaaaacaagacttgaacctgggcaaccccagctctccccaggg
gtttcaactattcatctgcacccacagttcccagtagtggttgaaaagacatcccctcct
gtgcctgtggaggtggctcctgaaggttctacatcaagtgccagccaagtgattgctcct
acgcaagtaacagaaatcaacgaatgtactgtgaacccggatatttgcggagcaggacac
tgcatcaacctgccggtgaggtatacctgcatatgctacgagggctacaagttcagtgag
cagcagaggaagtgcattgacattgatgaatgtgctcaggcccagcatctctgctcccag
ggtcgctgtgagaacacagagggaagtttcctgtgtatttgcccagcagggtttatagcc
agtgaggagggttctaactgtatagatgtggatgaatgtctgaggcccgatgtgtgtagg
gacggccgctgcatcaacactgctggggccttccgatgcgaatactgtgacagtgggtac
cggatgtcacgacggggccactgtgaggatatcgatgagtgtctgaccccaagtacctgt
cccgaggaacaatgcgtgaattccccaggttcttaccagtgtgtgccctgcacagaaggg
ttccgtggctggaatggacaatgcctcgatgtggacgagtgcctgcagccaaaggtctgt
accaatggttcctgcaccaacctggaaggctcctacatgtgttcctgccacaagggctac
agccccacaccagaccatagacactgtcaagatattgatgaatgtcagcaagggaacctg
tgcatgaacgggcagtgcaaaaacactgacggctccttccggtgtacctgtgggcagggc
tatcagctgtcagcggctaaagaccaatgtgaagatattgacgaatgcgagcaccgtcac
ctctgctctcacgggcagtgcaggaacacagagggctccttccagtgtttgtgcaaccag
ggttacagagcatctgtgcttggagaccactgcgaggatatcaatgaatgcttggaggac
agtagtgtctgccagggaggtgactgcatcaatacagcagggtcctatgactgcacgtgc
ccggatggactccagctgaatgacaataagggctgtcaagacattaatgaatgtgcacag
ccaggactctgtgcacctcatggggagtgtctaaacacacaaggctcattccactgtgtc
tgtgaacaagggttctccatctctgcagatggtcgtacttgtgaagatattgatgagtgt
gttaacaacactgtgtgtgacagtcacggcttctgtgacaacacagccggctctttccgc
tgcctctgttatcagggctttcaagccccacaggatgggcaagggtgtgtggatgtgaac
gaatgtgaactgctcagtggtgtatgtggggaggctttctgtgaaaatgtggaagggtcc
ttcctgtgcgtgtgtgccgatgagaaccaggagtacagccccatgactgggcagtgtcgc
tcccgggctactgaagattcaggtgtggatcgtcagcccaaagaagaaaagaaggagtgt
tattataatctcaatgatgccagtctctgtgataacgtgctggcccccaacgtcaccaaa
caagagtgctgctgtacatcgggcgccggctggggagacaattgtgagatcttcccttgc
ccagtccaggggactgctgagttctcggaaatgtgccctagaggaaaaggttttgtccct
gctggagaatcctcttacgaaaccggtggtgagaactacaaagatgctgacgaatgcctg
ctgtttggagaggaaatctgcaaaaacggttactgtttgaacactcagcctgggtatgaa
tgctactgcaaggaagggacatactacgatcctgtcaaattacagtgttttgatatggat
gaatgccaagaccctaacagttgtatcgatggccagtgtgttaatacagagggctcttac
aactgcttttgcacccacccaatggtcctggatgcctctgagaagagatgtgtgcagcca
actgaatcaaatgaacaaatagaagaaaccgatgtctatcaagatctgtgctgggagcat
ctgagtgaggagtacgtgtgtagccgtcctcttgtaggcaagcagacgacatacacagag
tgctgctgtttgtacggggaggcatggggcatgcagtgtgctctctgccccatgaaggac
tcagatgactatgcccagctgtgcaacatccctgtgacaggacggcggcgaccatatgga
cgggatgcgttggtggacttcagtgaacagtatggcccagaaacagacccttacttcatt
caggatcgctttctaaacagctttgaggagctacaggctgaggaatgtggcatcctcaac
ggctgtgaaaatggccgctgtgtaagggttcaggaaggttatacttgcgattgctttgat
ggatatcatctggatatggccaagatgacctgtgttgatgtaaatgaatgcagcgagctg
aataatcggatgtctctctgcaagaacgccaagtgcattaacacagaaggctcctacaaa
tgcgtgtgtctaccaggctacgtaccatctgacaagcccaactactgtacaccactgaac
accgctttgaatttagacaaagacagtgacctggagtga

DBGET integrated database retrieval system