KEGG   Rattus norvegicus (rat): 64465
Entry
64465             CDS       T01003                                 

Gene name
Cdc42
Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04660  T cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04912  GnRH signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    64465 (Cdc42)
   04014 Ras signaling pathway
    64465 (Cdc42)
   04015 Rap1 signaling pathway
    64465 (Cdc42)
   04370 VEGF signaling pathway
    64465 (Cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64465 (Cdc42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    64465 (Cdc42)
   04520 Adherens junction
    64465 (Cdc42)
   04530 Tight junction
    64465 (Cdc42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    64465 (Cdc42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    64465 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    64465 (Cdc42)
   04670 Leukocyte transendothelial migration
    64465 (Cdc42)
   04062 Chemokine signaling pathway
    64465 (Cdc42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    64465 (Cdc42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    64465 (Cdc42)
  09158 Development and regeneration
   04360 Axon guidance
    64465 (Cdc42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64465 (Cdc42)
   05205 Proteoglycans in cancer
    64465 (Cdc42)
   05203 Viral carcinogenesis
    64465 (Cdc42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    64465 (Cdc42)
   05211 Renal cell carcinoma
    64465 (Cdc42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    64465 (Cdc42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64465 (Cdc42)
   05135 Yersinia infection
    64465 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    64465 (Cdc42)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    64465 (Cdc42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64465 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    64465 (Cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64465 (Cdc42)
   03036 Chromosome and associated proteins [BR:rno03036]
    64465 (Cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64465 (Cdc42)
   04031 GTP-binding proteins [BR:rno04031]
    64465 (Cdc42)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    64465 (Cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    64465 (Cdc42)
  Macropinocytosis
   Ras GTPases
    64465 (Cdc42)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    64465 (Cdc42)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   64465 (Cdc42)
  Exosomal proteins of breast milk
   64465 (Cdc42)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    64465 (Cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 64465
NCBI-ProteinID: NP_741991
RGD: 71043
Ensembl: ENSRNOG00000013536
UniProt: Q8CFN2
Position
5
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaattcccgtcggagtatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg
caagaggattatgacagactacgaccgttaagttatccacagacagatgtttttctagta
tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgtcgggacccaaattgatctcaga
gatgacccttctactattgagaaacttgccaagaacaaacagaagcctattactccagag
actgctgaaaagctggcgcgggatctgaaggctgtcaagtatgtggagtgttccgccctc
acacagaaaggcctaaagaatgtgtttgatgaagcaatattggctgccttggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system