KEGG   Rattus norvegicus (rat): 64633Help
Entry
64633             CDS       T01003                                 

Gene name
Rab5a
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05146  Amoebiasis
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    64633 (Rab5a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64633 (Rab5a)
   04145 Phagosome
    64633 (Rab5a)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    64633 (Rab5a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    64633 (Rab5a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    64633 (Rab5a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    64633 (Rab5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64633 (Rab5a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64633 (Rab5a)
   04031 GTP-binding proteins [BR:rno04031]
    64633 (Rab5a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    64633 (Rab5a)
 Endosome - Lysosome transport
    64633 (Rab5a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64633 (Rab5a)
  Exosomal proteins of other body fluids (saliva and urine)
   64633 (Rab5a)
  Exosomal proteins of colorectal cancer cells
   64633 (Rab5a)
  Exosomal proteins of bladder cancer cells
   64633 (Rab5a)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    64633 (Rab5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Motif
Other DBs
NCBI-GeneID: 64633
NCBI-ProteinID: NP_073183
RGD: 620936
UniProt: M0RC99
Position
9q11
AA seq 215 aa AA seqDB search
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFSRAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactggttcttctaggagagtctgctgttggcaaatcaagtctggtgcttcgcttt
gtgaaaggccaatttcatgagtttcaagagagtaccattggggctgcctttctaacccaa
actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggccaagaa
cggtatcatagcctagcaccaatgtactaccgaggagcacaagccgccatagttgtgtat
gatattacaaatgaggagtccttttcgagagcaaaaaactgggttaaagaacttcaaagg
caagcaagtcctaatattgtgatagctttgtcaggaaacaaggctgacttagcaaataaa
agagctgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg
gagacatcagctaagacatcaatgaatgtaaatgaaatatttatggcaatagctaaaaag
ctgccaaagaacgaaccacaaaatccaggcgcaaactcagccagaggaagaggagtagac
cttactgagcctgcacagccagccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system