KEGG   Rattus norvegicus (rat): 65158
Entry
65158             CDS       T01003                                 

Gene name
Rab2a, Rab2
Definition
(RefSeq) RAB2A, member RAS oncogene family
  KO
K07877  Ras-related protein Rab-2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    65158 (Rab2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    65158 (Rab2a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    65158 (Rab2a)
   04031 GTP-binding proteins [BR:rno04031]
    65158 (Rab2a)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    65158 (Rab2a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   65158 (Rab2a)
  Exosomal proteins of other body fluids (saliva and urine)
   65158 (Rab2a)
  Exosomal proteins of colorectal cancer cells
   65158 (Rab2a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    65158 (Rab2a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU Gtr1_RagA AAA_22 DAP3
Other DBs
NCBI-GeneID: 65158
NCBI-ProteinID: NP_113906
RGD: 68323
Ensembl: ENSRNOG00000005963
UniProt: P05712
Position
5q13
AA seq 212 aa
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTMGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNASHGGNQGGQQAGGGCC
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgtacgcctatctcttcaagtacatcatcatcggcgacacaggtgttggtaaatcg
tgcttattgctacagtttacagacaagaggtttcagccggtgcatgacctcacaatgggt
gtagagtttggtgctcgaatgataaccattgatgggaaacagataaaactccagatctgg
gatacagcagggcaggagtcctttcgttctatcacaaggtcatattacagaggtgcagcg
ggggctttactagtgtatgatattacaaggagagacacgttcaaccacttgacaacctgg
ttagaagacgcccgtcagcattccaattccaacatggtcatcatgcttattggaaataaa
agtgacttagaatctaggagagaagtgaaaaaggaagaaggtgaagcttttgcacgagag
catggacttatcttcatggaaacttctgccaagactgcttctaatgtagaggaggcattt
attaacacagcaaaagaaatttatgaaaaaatccaagaaggggtctttgacattaataat
gaggcaaacggcatcaaaattggccctcagcatgctgctaccaatgcatctcacggaggc
aaccaaggagggcagcaggcagggggaggctgctgctga

DBGET integrated database retrieval system