KEGG   Rattus norvegicus (rat): 679155
Entry
679155            CDS       T01003                                 

Gene name
Zbtb7c
Definition
(RefSeq) zinc finger and BTB domain containing 7C
  KO
K10494  zinc finger and BTB domain-containing protein 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    679155 (Zbtb7c)
   04121 Ubiquitin system [BR:rno04121]
    679155 (Zbtb7c)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    679155 (Zbtb7c)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     679155 (Zbtb7c)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF2457 zf-C2H2_6 Autophagy_act_C zf-met RXT2_N Mpp10 GAGA TFB6 Tim54
Other DBs
NCBI-GeneID: 679155
NCBI-ProteinID: NP_001120847
RGD: 1591841
Ensembl: ENSRNOG00000047924
UniProt: B2GV04
Position
18q12.2-q12.3
AA seq 619 aa
MANDIDELIGIPFPNHSSEVLCSLNEQRHAGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGNLASQPYVYEIDFVQPEALAAILEFAYTSTLTITASNVKHILNAARMLEIQCIV
NVCLEIMEPGGNVGEEDDKEEEDDDEDDDDEDDEEEEEEEEEEEEDDTEDFADQENLPDP
QDINCPQSPSKTDCLTEKDYSDTPRDFPDSFQPESPGHLGVIRDFSIESLLRENLYPKAS
IPDRRPSLSPFAPEFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKDRKIKEEEKEELAPP
PPPPFSSDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGSLFPPWPLVEERKLKP
KASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCSICEVRFTRQDKLKIHMRKHTGERPY
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRG
RKPAAWRAASLLFGPGGPSADKAAFVMPPALGDVGGHLGGTAVCLPGPSPAKHFLASPKG
TLSLQELERQFEETQMKLFGRAQLEAERNAGGLLALALAENVAATRPYFPLPDPWAAGLA
GLPGLTGLNHVASMSEANN
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggccaatgacatcgatgagctcatcggcatccctttccctaaccacagcagtgaggtg
ctatgcagcctcaacgagcagcggcatgcggggctgctgtgcgacgttctgctggtggtc
caggagcaagagtaccggacacaccgctcggtgctggcggcctgcagcaaatacttcaag
aagctcttcacggccggtaacctggccagccagccctacgtctatgagattgactttgtc
cagcccgaagctctggctgccatcctggagtttgcctacacctccacactcaccatcact
gcctccaatgtcaagcacatcctcaacgctgccaggatgctggagatccagtgcattgtg
aatgtgtgcctggagatcatggagcctggcggcaacgtcggtgaggaggatgacaaggag
gaggaggacgacgatgaagacgacgatgatgaagatgatgaggaggaagaggaagaggaa
gaagaggaggaggaggatgacactgaggactttgctgaccaggaaaacttgcctgacccc
caggacatcaactgcccccagagcccctccaagacagactgtctcacagagaaggactat
tctgacacacccagggacttccccgactccttccagcccgaaagccctggccacctggga
gtgatccgggacttctccattgaatctctgctgagggagaacttgtaccccaaggccagc
atccctgacaggagaccctccttatctccatttgccccagaattcttcccgcacctctgg
ccaggtgactttggtgcctttgcccagctgcctgaacagcccatggacagtgggccactg
gatctagtcatcaaggacagaaagatcaaggaggaggagaaagaggagctggccccaccc
ccaccccctcccttctctagcgacttcttcaaggacatgtttcctgacctgcctggtggg
ccgctgggccccatcaaggcagagaatgactatggtgcctatctcaacttcctgagtgcc
acccacctggggagcctcttcccaccctggccgctggtggaggagcgcaagctgaagccc
aaggcctctcagcagtgccccatctgccacaaggtcatcatgggggctgggaagctgccc
cggcacatgaggacccacaccggagagaagccgtacatgtgcagcatctgcgaggtccgc
ttcaccaggcaggacaaactgaagatccacatgcggaagcacacgggggagcggccctac
ttgtgcattcactgcaacgccaagtttgtgcacaactacgacctcaagaaccacatgcgc
atccacacgggcgtgcggccctaccagtgtgagttctgctacaagagcttcacgcgctcc
gaccacctgcaccgccacatcaagaggcagagctgccgcatggcgcgaccccggcgtggt
cgcaagcctgctgcctggagggcagccagcctgctctttgggccgggtggcccctcagcc
gacaaagcggccttcgtgatgccacccgcgctgggcgacgtgggtggccacctgggcggc
acagccgtgtgcctcccgggccccagccctgctaagcacttcctggcatcacccaagggc
accctgagcctgcaggagctggaacgtcagttcgaggagacgcagatgaagctattcgga
cgcgcgcagctcgaggccgagaggaacgccggcggcctcctggccctggcactggctgag
aacgtagccgccactcggccctacttcccactgcctgacccctgggcggcaggcttggct
ggcctccctggtctcaccggcctcaaccatgtggcctccatgtctgaagccaacaactag

DBGET integrated database retrieval system