KEGG   Rattus norvegicus (rat): 83465
Entry
83465             CDS       T01003                                 

Gene name
Celsr2, Megf3
Definition
(RefSeq) cadherin, EGF LAG seven-pass G-type receptor 2
  KO
K04601  cadherin EGF LAG seven-pass G-type receptor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    83465 (Celsr2)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    83465 (Celsr2)
   04515 Cell adhesion molecules [BR:rno04515]
    83465 (Celsr2)
Peptidases and inhibitors [BR:rno01002]
 Mixed peptidases
  Family P2
   83465 (Celsr2)
G protein-coupled receptors [BR:rno04030]
 Adhesion receptor family
  Cadherin EGF LAG (CELSR)
   83465 (Celsr2)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   83465 (Celsr2)
SSDB
Motif
Pfam: Cadherin GAIN Laminin_G_2 7tm_2 Laminin_G_1 GPS Cadherin_3 EGF Laminin_EGF Cadherin_pro hEGF Cadherin_4 Dicty_CAR
Other DBs
NCBI-GeneID: 83465
NCBI-ProteinID: NP_001178039
RGD: 69237
Ensembl: ENSRNOG00000020058
UniProt: G3V8P3
Position
2q34
AA seq 2919 aa
MRSRAASAPLPTPLLPLLLLLLLLPPSPLLGDQVGPCRSLGSGGRGSSGACAPVGWLCPA
SASNLWLYTSRCRDSGIELTGHLVPHHDGLRVWCPESGAHIPLPPSSEGCPWSCRLLGIG
GHLSPQGTLTLPQEHPCLKAPRLRCQSCKLAQAPGLRAGEGSREESMGGRRKRNVNTAPQ
FQPPSYQATVPENQPAGTSVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPITGA
VTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRE
NLEVGYEVLTVRATDGDAPPNANILYRLLEGPGGSPSEVFEIDPRSGVIRTRGPVDREEV
ESYKLIVEASDQGRDPGPRSSTAVVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLR
VTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRIRAQDGG
RPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGENARL
EYSLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTI
LDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS
QSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTVN
VNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVS
YTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISAT
DRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYILRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQI
VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYILVIQATSAPLVSRATVHVRLLDRNDNP
PVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTG
ELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCSLRVTIITDEMLTHSITLRLEDMSPER
FLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFL
PSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSS
VLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGHCRSREGGYTCLCRDGYTG
EHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPFCQVTTRSFPARSFITF
RGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVS
PFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVSVDGCDTGVALRFGAMLG
NYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRHFVGCMKNLQVDSRHVDMAD
FIANNGTVPGCPTKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMANPQRFL
GSSLVAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLRAGHVVLSVEGT
GLQASSLRLEPGRANDGDWHHAQLSLGASGGPGHAILSFDYGQQKAEGNLGPRLHGLHLS
NMTVGGVPGPASSVARGFRGCLQGVRVSETPEGVSSLDPSRGESINVEPGCSWPDPCDSN
PCPTNSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPHGYICECLPN
YLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPSSPT
CLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAI
EAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERL
QRNESGLDSGRSQRLALLLRNATQHTSGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQ
DVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPF
TIVTPNIVISVVRLDKGNFAGTKLPRYEALRGERPPDLETTVILPESVFREMPPMVRSAG
PGEAQETEELARRQRRHPELSQGEAVASVIIYHTLAGLLPHNYDPDKRSLRVPKRPVINT
PVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCE
VVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALMITFLFLTL
LRALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLE
ALHLYRALTEVRDVNASPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLI
WSFAGPVAFAVSMSVFLYILSARASCAAQRQGFEKKGPVSGLRSSFTVLLLLSATWLLAL
LSVNSDTLLFHYLFAACNCVQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTKSTL
TSSYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQVPPGLG
DPSGLFMEGQAQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEAAFPGEQGWDSL
LGPGAERLPLHSTPKDGGPGSGKVPWPGDFGTTTKENSGSGPLEERPRENGDALTREGSL
GPLPGPSTQPHKGILKKKCLPTISEKSSLLRLPLEQGTGSSRGSTASEGSRNGPPPRPPP
RQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
NT seq 8760 nt   +upstreamnt  +downstreamnt
atgcggagccgggctgccagcgcccccctcccaacgccactgctgccgctgctactgctg
ttgctgctgctgccgccgtcgccactactgggagatcaagtggggccctgtcgttctctg
gggtccgggggacgcggctcctctggggcctgcgcccccgtgggctggctctgcccagcc
tctgcttcgaacctctggctctacaccagccgctgcagagattcgggcattgagctgacc
ggccacctggtgccccatcacgatggcctgagggtttggtgtccagaatcaggggctcat
atccctcttccgccatcctctgaaggctgcccctggagctgtcgactcctgggtatcgga
ggacacctttctccacaaggcacgctgaccctgcctcaagaacacccttgcttaaaggcc
ccacggctcagatgccagtcttgcaagctggcacaggccccagggctcagggctggggaa
ggatcacgagaggaatctatgggtgggcgcaggaaaaggaatgtgaatacagctccccag
ttccagcctcccagctaccaggccacagtgcccgagaaccagcctgctggtacctctgtt
gcctccttaagagccattgatcccgatgagggtgaggcgggtcgacttgagtacaccatg
gatgccctctttgatagccgctccaatcatttcttctccttggacccaatcactggtgct
gtcaccacagctgaggagctggatcgggagaccaagagcacccatgtcttcagggtcacc
gcacaggatcatggtatgccccgacggagtgccttggccacacttactatcttagtgact
gacaccaatgatcacgaccctgtttttgagcagcaagaatacaaggagagcctcagggag
aacctggaggttggctatgaggtgcttacagtcagggccaccgatggcgatgcccctcct
aatgccaacattctgtaccgcctgctggaggggcctggaggcagcccctcagaagtcttt
gagatcgatcctcgctctggggtgatccgaacccgcggccccgtagatcgggaagaagtg
gaatcctacaaattgatagtggaggcgagtgaccagggtcgggacccaggcccacggagc
tccacagctgtcgtcttcctgtctgtggaagatgataatgacaacgccccccagtttagc
gagaagcgctacgtggttcaggtgcgggaggatgtgaccccaggagcccccgttctccga
gtcacggcctcggacagagacaagggcagcaacgccctggtgcactatagtatcatgagc
ggcaacgctcggggacagttctatctggatgctcagactggagccctggatgtggtgagc
ccactcgactatgagacaaccaaagaatatacactgcggatccgggcccaggatggtggc
cggcctccactttccaacgtctccggtctagtaaccgtgcaggtcctagacatcaatgac
aacgcccccatctttgtcagcacccctttccaggccacggtcctagagagtgtaccttta
ggctacctggttctgcatgtccaagcgattgatgctgatgccggagagaacgcccgcctc
gaatacagcctggctggggttgggcacgacttccccttcaccattaacaacggcacaggc
tggatctcggtggccgcggagttggaccgggaagaggttgatttctacagcttcggagta
gaagccagggaccacggcaccccagcactcaccgcctcagccagtgtcagtgtaaccatc
ctggatgtcaatgacaacaacccaacctttacgcagccggagtacacggtgcggctcaac
gaggacgcggctgtgggcaccagtgtggtgacggtgtcagccgtggatcgagatgctcac
agtgtcattacctaccagatcaccagcggcaacacccgcaaccgcttctctatcaccagc
caaagcgggggtggcctggtctccctggccttaccgctggactacaaactcgagcggcag
tatgtgctggccgtgactgcctcggatggcacaaggcaggacacagctcagatcgtggtg
aatgtcactgatgccaacacccatcgtcccgtcttccagagctcccactatacggtgaat
gttaatgaagaccggccagcaggcaccacagtggtgctgatcagtgctacagacgaggac
acaggggagaatgcccgaatcacctactttatggaggacagcatccctcagttccgcatc
gatgcagacactggggccgtcaccacccaggctgagctggactatgaagatcaggtgtct
tacaccctggccatcaccgctcgggacaatggcatcccccagaagtcggacacaacctac
ctggagatcctggtaaatgacgtgaatgacaatgccccccagttcctcagagattcctac
caggggagtgtctatgaggatgtgccacccttcaccagcgtcctgcagatctcagccacc
gatcgcgactccggtctgaacggcagggttttctacaccttccaaggaggggacgatgga
gatggtgactttattgtagagtccacatcaggcatcgtgcgcacactgcggaggctggat
cgtgagaatgtggcccagtacatcttgagagcgtacgcggtggacaaggggatgccgcca
gcccgcacacccatggaagtgacagttactgtactggatgtgaatgacaatccccccgtc
tttgaacaggatgagtttgatgtatttgtggaagagaacagccccatcggactggctgtg
gcccgggtcacagccaccgacccagacgaagggaccaatgcacagatcatgtaccagata
gtggagggcaatatccctgaggtctttcagctggacatcttctcgggcgagctaacggcc
ctcgtagatttggactacgaggaccgacctgaatatatcctggtcatccaggctacgtct
gctcccttggtgagcagggctactgtccatgtccgcctcctcgaccgcaatgataacccg
ccagtgctgggcaactttgagattcttttcaacaactatgtcaccaaccgctcgagcagc
ttccctgggggtgctataggccgcgtgcctgcccatgaccccgatatctcagacagcctg
acgtacagctttgagcgaggaaatgaactcagcctggtcctactcaatgcctccaccggt
gagctgagactgagccgggcactggacaacaaccggcccctggaagccatcatgagtgtg
ctggtgtcagatggtgtccacagtgtgacagcccagtgctcactccgtgtcaccatcatc
acagacgagatgctcacacacagcatcacgctgcgcttggaagacatgtctccagaacgc
tttctgtccccactgctgggactcttcattcaggctgtggcagccacattggccacaccc
ccagatcacgtggtggtcttcaatgtgcagagggatactgatgccccaggcggccatatc
ctcaacgtgagcctgtcagtgggccagcccccaggacccgggggtgggccaccctttcta
ccttcagaggatctgcaggagcgcctgtacctcaaccgcagcctgctcaccgccatctca
gctcagcgcgtgctccccttcgacgacaacatttgcctgcgagaaccctgcgagaattac
atgcgctgtgtgtccgtgctgcgcttcgactcctctgcgccctttatcgcttcctcttcg
gtgctcttccgccccatccaccctgtcgggggtctgcgctgtcgctgcccaccaggcttc
acaggcgactactgcgagactgaggtggacctctgttactcaagaccttgtggaccccat
gggcactgccgcagtcgagagggtggctatacctgcctctgtcgcgatggctacacgggg
gagcactgtgaagtgagtgcccgctcaggccgttgtactccaggagtctgcaagaatggg
ggtacctgtgtcaacctgttggtgggaggcttcaaatgtgactgcccatccggggacttt
gagaagcccttctgccaggtgaccacacgcagcttcccagcccgctccttcatcaccttc
cggggccttcgccagcgcttccacttcaccctggccctctcgtttgctaccaaggagcgt
gacgggctactgctgtacaacgggcgcttcaatgagaagcatgacttcgtagctctcgag
gtgatccaggagcaggtgcagctcaccttctctgcaggggaatccaccaccacggtgtct
ccattcgtgcctggaggggtcagtgatggccagtggcatacagtacagctgaagtactac
aataagccgctgttgggtcagacaggacttccacaaggcccatctgagcagaaggtggct
gtggtgtccgtggatggctgtgacacaggggtggctctgcgcttcggagctatgctgggc
aactactcctgtgctgcccagggcacccaaggaggcagcaagaagtctctggacctgaca
gggcccttgttgctgggtggggtgccagatctgcccgagagtttccctgtccgaatgcgg
cactttgtgggctgcatgaagaacctccaggtggatagccggcacgtcgacatggccgac
ttcatcgccaacaatggcactgtgcctggctgccccaccaagaagaacgtgtgtgacagc
aacacttgccataatggtggcacctgtgtgaaccagtgggacgcattcagctgcgagtgt
cccctaggcttcgggggcaagagctgtgcccaggaaatggccaatccccagcgtttcttg
ggcagcagccttgtggcctggcatggcctctctctgcccatctctcagccctggcacctc
agcctcatgttccgcacacgccaggcagatggcgtcctgctgcaggccgtcaccaggggg
cgcagcaccatcaccctgcagcttcgggcaggccacgtagtgctaagtgtggagggcaca
gggctccaggcctcatccctgcgtctggagccaggccgagccaatgatggtgactggcat
cacgcacagctgtcactgggagctagcgggggccctggccacgccatcctgtcctttgac
tatgggcaacagaaggcagagggtaatctgggccctcggctgcacgggctgcacctgagc
aatatgacagtcgggggagttcccgggccagccagcagtgtggcccgtggcttccggggc
tgtttgcagggtgtgagggtaagcgagacacccgagggtgttagcagtctggatcccagc
cgtggggagagcatcaatgtggagccaggctgtagctggccagatccctgtgactcgaat
ccatgtcccaccaacagctactgcagcaacgactgggacagctattcttgtagctgtgat
ccaggttactatggtgacaactgtacaaatgtgtgtgacctgaacccatgcgagcaccag
tctgtgtgtacccgaaaacccagtgcaccccacggctacatctgcgagtgtttaccaaat
taccttgggccctattgtgagaccaggattgaccaaccttgcccccgtggctggtgggga
caccccacatgtggtccatgcaactgcgatgtcagcaaaggctttgacccagactgcaac
aagacaagtggcgagtgccactgcaaggagaatcactaccgaccccccagcagccccact
tgcctcttgtgtgactgttaccccactggctctttgtcccgagtctgtgaccctgaggat
ggccagtgtccatgcaagcctggagtcattgggcgtcagtgtgatcgctgtgacaaccct
tttgctgaggtcaccaccaatggctgtgaagtgaattatgacagctgcccacgggccata
gaggctgggatctggtggccccgcacgcggtttgggctacctgctgctgccccctgcccc
aagggctcctttgggactgctgtgcgccactgtgatgagcacaggggctggctcccgcca
aacctcttcaactgcacgtcagtcaccttctcagagctaaagggctttgccgagcggcta
cagcgaaacgaatcaggcctggactcaggacgctcccagaggctggccctgctcctgcgt
aatgccacacagcacacctctggctacttcggcagtgatgtcaaggtggcctaccagctg
gccacacgactgctggctcatgagagtgcccagcggggctttgggctgtccgccacacag
gatgtgcacttcactgagaatctgctgagggtgggcagcgccctcctggatgcggccaat
aagaggcactgggaactgatccagcagacagagggtggcactgcctggctgctccagcac
tatgaggcttatgccagtgccctggcccagaatatgcggcatacctacctgagccccttc
actatcgtcacacccaacattgtcatctctgtggtgcgcctggataaggggaactttgct
gggaccaagctgccccgttatgaggcgttacgtggggagcgccctccagatcttgagacc
acagtcattttgccagagtctgtcttcagagagatgcctcccatggtgagatctgcagga
cctggtgaagcccaggagactgaggagctggcccggcggcagcggaggcacccagaactg
agtcagggcgaggcagtggccagtgtcatcatttaccacacgctggctggactgctgccc
cacaactacgacccagataagcgtagcctgagagtccccaagcgcccagtcatcaacaca
cctgtggtaagcatcagtgtccacgatgatgaggagctcctgccacgggcactggacaag
ccagtcacagtgcagttccgactgctggagacggaggagcgaaccaagcccatctgtgtc
ttctggaaccattcgatcctggtcagtggcacaggtggctggtccgccagaggctgcgag
gttgtcttccgtaacgagagccatgtcagctgccagtgcaaccatatgacaagctttgct
gtgctcatggatgtgtcccgacgagagaatggtgagattttgccactgaagaccctgacg
tatgtggcccttggagtcaccttagctgccctgatgatcaccttcctcttcctcaccctc
cttcgagcccttcgctccaaccagcatggcatccgacgcaacctcacagctgccctgggc
ctggcccagctggtctttctcctggggatcaaccaggctgacctcccttttgcttgcaca
gtcattgccatcctgctgcacttcctgtacctttgcaccttctcctgggctctgctggag
gccttacacctgtaccgggcgctcacagaggtgcgagacgtcaatgccagccccatgcgt
ttctactacatgctgggctggggcgttcctgctttcatcacaggtctggctgtgggcttg
gatcccgaaggctatggaaaccctgacttctgctggctctccatctacgatacgctcatc
tggagttttgctggaccagtggcctttgctgtttcgatgagtgtcttcctgtatatcctg
tcggcccgagcctcctgtgctgcccaacgtcagggcttcgagaagaaaggccctgtctca
ggcctgcgctcctccttcactgtcctcctgctgctgagtgccacatggctgctggcactg
ctgtctgtcaacagcgacactctcctcttccactacctcttcgcggcctgcaattgtgtc
cagggccccttcatcttcctctcctacgtggtgctcagcaaggaggtccggaaagcactc
aagttcgcctgcagccggaagcccagccctgaccctgccttgaccactaagtctaccctg
acctcgtcctataactgccccagcccctatgcagatgggaggctgtaccagccttacgga
gattcggccggctccttgcacagtgccagccgctcaggcaagagtcagcccagctacatc
cccttcttgctgagggaggagtccacgctgaaccctggccaggttccccctggcctaggg
gacccaagtggcctattcatggaaggccaagcccagcaacacgatcccgacacggactct
gacagtgacctgtccctggaagatgaccagagtggttcctacgcttctacccactcatca
gacagcgaggaagaggaggaggaggccgccttccctggcgagcagggctgggacagcctg
ctgggtcctggagctgagagactgccccttcacagtacccccaaggatgggggtccaggg
tctgggaaggtcccttggccaggagactttgggaccacaacaaaggagaatagtggtagt
gggccccttgaagagcggccacgggagaatggagatgctctaactcgggaagggtctctg
ggaccccttccgggcccttctacccaacctcacaaaggcatcctcaagaagaagtgtctg
cccaccatcagcgaaaagagtagcctcctaaggttgcccctggagcagggcacagggtct
tcccggggctccaccgccagtgagggcagcaggaacggacctcctccacgcccaccaccg
cgccagtctctccaggaacagctgaatggggtcatgcccatcgccatgagcatcaaggca
ggcactgtggatgaggactcttctggctccgaatttctcttctttaacttcctgcattaa

DBGET integrated database retrieval system