KEGG   Rattus norvegicus (rat): 83727
Entry
83727             CDS       T01003                                 

Gene name
Fbn1
Definition
(RefSeq) fibrillin-1 precursor
  KO
K06825  fibrillin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    83727 (Fbn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    83727 (Fbn1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   83727 (Fbn1)
SSDB
Motif
Pfam: EGF_CA cEGF TB FXa_inhibition EGF hEGF EGF_3 Plasmod_Pvs28 Fibrillin_U_N EGF_MSP1_1
Other DBs
NCBI-GeneID: 83727
NCBI-ProteinID: NP_114013
RGD: 620908
Ensembl: ENSRNOG00000007302
UniProt: Q9WUH8
Position
3
AA seq 2872 aa
MRRGGLLEVALAFTLLLESYTSHGADANLEAGSLKETRANRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQISPSCGSRSIQHCS
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGVCD
GGECTNTVSSYFCKCPPGFYTSPDGTRCVDVRPGYCYTTLTNGRCSNQLPQSITKMQCCC
DVGRCWSPGVTVAPEMCPIRSTEDFNKLCSVPLVIPGRPDYPPPPLGPLPPVQPVPGFPS
GPVIPVPRPPPEYPYPSPSREPPKVLPFNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKG
FQLDIRGECIDVDECEKNPCTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDECLQNGR
ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICK
PGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRS
TCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTS
AGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNG
QCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTLD
PTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQVDPICGKG
YSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPSGMTLDATGRICLDIRLETCF
LKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDI
TNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPD
LCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCE
CPSGHQLSPNISACIDINECELSANLCPSGRCVNLIGKYQCACNPGYHPTHDRLFCVDID
ECSIMNGGCETFCTNSDGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPG
EYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTG
CTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHAD
CKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSA
DGKACEDINECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCIS
GNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSK
ASCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQG
GKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYM
QVNGGNNCMDMRRSLCYRNYHADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIP
STDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFY
NDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNI
CSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHG
FILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVL
DPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCL
CPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELC
PTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYIL
EGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF
RCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPG
YQRRPDGEGCIDENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYC
FSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTN
GADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFIC
KNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHH
TACIDNNECTSEINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQH
GCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHVCGGASCHNTLGSYKCMCPAGFQY
EQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYLRIGQGHCVSGMGMGRGGPEP
PASGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASDIQDGSEMEANVSLASWDVE
KPASFAFNISHINNKVRILELLPALTTLMNHNKYLIESGNEDGFFKINQKEGVSYLHFTK
KKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH
NT seq 8619 nt   +upstreamnt  +downstreamnt
atgcggcgaggagggctgctggaggtcgcgctggctttcaccctgctcctcgagtcctac
acgagccatggggcggatgccaatctggaggctgggagcctaaaggagaccagagccaat
cgcgccaagagacgaggcggcggaggacacgatgctctgaaaggacccaatgtctgtgga
tctcgttataacgcatactgttgtcccggatggaaaaccttacctggtggaaatcagtgt
attgttcccatttgccggcattcctgtggggacggattctgctcaagaccaaacatgtgc
acttgcccatctggtcagatatcgccttcctgtggctccagatccatacaacactgtagc
atccgctgtatgaatgggggcagctgcagcgatgaccactgtctgtgccagaaggggtac
attggcactcactgcggacaacctgtctgtgaaagtggctgtctcaatggagggaggtgc
gtggccccaaatcggtgtgcatgcacatacggctttacgggaccccagtgtgaaagagat
tacagaacaggcccgtgttttactgtggtaagcaaccagatgtgccagggacagctcagc
gggattgtctgcaccaaaacactctgctgtgccacagtgggccgagcctggggccacccc
tgcgagatgtgtcctgcccagcctcacccctgccgccgcggcttcattcccaacatccgc
accggagcttgtcaagatgtggatgaatgtcaggctatcccggggctgtgtcaaggagga
aattgcattaataccgttggatcttttgagtgcaaatgccccgctggacacaaatttaat
gaagtgtcccaaaaatgtgaagatatcgatgagtgcagcaccatccctggtgtgtgcgat
ggcggggagtgtaccaacacggtcagcagttatttctgcaaatgtccccctggcttttac
acctctcccgatggcaccagatgcgtagatgttcgccctggttactgctacacaactctg
acaaatgggcgctgctctaaccagctgccacagtccataaccaaaatgcagtgctgttgt
gatgttggccggtgctggtctccaggggttactgtcgctcctgagatgtgtcccatcagg
tcaactgaggacttcaacaagctgtgctccgtccctctggtaatccccgggagaccagac
tatcctcccccacccctcggcccccttcctccggttcagcctgttcctgggtttccttcc
gggcctgtgataccggtcccccggccaccgccagaatacccgtatccatctccatcacgg
gaaccaccaaaggtgctgcctttcaacgttactgactactgtcaattggtccgctatctc
tgtcaaaatgggcgctgcattccaactcccggtagctaccgctgtgagtgcaacaagggc
ttccagctggatatccgtggcgagtgcatcgacgttgatgagtgtgagaaaaacccatgc
accggtggagaatgtatcaacaaccagggctcatatacctgtcactgccgagctggctac
cagagcacactcaccagaactgagtgcagagacatagatgagtgtctgcagaacggccgg
atctgtaacaacgggcgctgcatcaacacagatggcagcttccactgcgtgtgcaatgca
ggctttcacgtcacgagggacggaaagaactgtgaagacatggatgagtgcagcatcagg
aacatgtgcctgaatgggatgtgcatcaacgaagatgggagtttcaagtgtatttgcaaa
cctgggttccaactggcgtcagatggccgctactgcaaagatatcaatgagtgtgagact
cctggaatctgcatgaacggacgatgcgtgaacactgatggctcctacagatgcgaatgc
tttcccggattggctgtgggcctagatggacgtgtgtgtgttgacacacacatgcggagc
acatgctacggaggctacaggagaggccagtgtgtgaagccgttgtttggtgctgttacc
aaatcggaatgctgttgtgccagcaccgagtatgccttcggggaaccctgccagccgtgc
cctgcacagaattcagcggaatatcaggcactttgcagcagtggacccggaatgacatca
gcaggctctgatataaatgaatgtgcattagatcctgacatttgcccaaatggaatttgt
gaaaatctccgtgggacctacaaatgtatatgcaactcgggatacgaagtagacataact
gggaaaaactgtgtcgatattaatgagtgtgtgctgaacagtctactttgtgacaatgga
caatgtcgaaacacacctggaagttttgtctgtacctgccccaagggatttgtgtacaaa
cctgacttaaagacctgtgaagacattgatgaatgtgaatcgagtccttgcattaatgga
gtctgcaagaacagccctgggtctttcatttgcgaatgctctcctgaaagtactctggat
ccaacaaaaaccatctgcatagaaaccatcaagggcacttgctggcagactgtcattgac
gggcgatgtgagatcaatatcaatggagccaccttgaagtccgagtgctgctcctccctt
ggcgctgcctgggggagcccgtgcactatatgtcaagttgatcccatatgtggtaaaggg
tactcgagaattaaaggcacgcaatgtgaagatatcaatgagtgtgaagtattcccggga
gtatgcaagaatggcctgtgtgttaactccaggggttccttcaagtgcgagtgtcccagt
ggaatgactttggatgctacaggaagaatctgtcttgatatccgcctggagacctgcttc
ctgaagtacgacgacgaggagtgcacgctgcccattgctggccgccaccgaatggatgcc
tgctgctgctccgttggggcagcctggggaacagaagagtgtgaggagtgtccattgaga
aacagccgggagtatgaggaactctgtccccgaggacccgggtttgccacgaaagacata
acaaatgggaaacctttcttcaaagacattaatgagtgcaagatgatacccagcctctgt
acccacggcaagtgtaggaacaccattggcagcttcaagtgcaggtgtgacagtggcttt
gctttggactctgaagagaggaactgcacagacattgacgagtgccgcatatctcctgac
ctctgtggccgaggccagtgtgtgaacaccccgggggatttcgaatgcaagtgtgacgaa
ggctatgaaagtggcttcatgatgatgaagaactgtatggatattgatgaatgccagaga
gatcctctcctctgtcgaggaggcatctgccacaacacagagggaagttatcgctgtgaa
tgtccttctggccaccaactgtctcccaacatctctgcgtgcattgacatcaacgagtgt
gaactgagtgccaacctctgtcccagcgggcgttgtgtgaacctcattgggaagtaccag
tgtgcctgcaacccgggctatcaccccactcacgataggcttttctgtgtcgacattgat
gagtgcagcataatgaatggtggttgtgagaccttctgcacaaactctgacgggagctat
gaatgtagctgtcagccaggcttcgcgctgatgccagaccagcgatcgtgcacagacatt
gatgagtgtgaagataaccccaatatctgtgatggtggccagtgcacaaacattcctgga
gagtacaggtgcttgtgctatgatgggttcatggcgtctgaagacatgaagacttgtgtt
gatgtcaatgaatgtgacctgaatcccaacatctgcctcagtgggacctgcgagaacact
aaaggctccttcatctgccactgtgatatgggctactcagggaaaaaaggaaaaacgggc
tgcacagatatcaatgaatgtgagattggagcacacaactgtggcagacatgctgtgtgc
acaaatacagcagggagcttcaagtgcagctgcagtcctggctggattggagatggcatt
aagtgcacagatctggatgaatgctctaatggaacccacatgtgcagccaacacgcagac
tgcaagaacaccatggggtcatatcgctgtctctgtaaggatggctacacaggggatggc
ttcacctgcacagaccttgacgagtgctctgagaacctgaacctctgtggcaatggccag
tgcctcaatgcccctggcgggtaccgctgtgaatgcgacatgggcttcgtgcccagtgct
gatgggaaggcctgtgaagatatcaacgagtgctcccttccaaacatctgtgtctttgga
acttgccacaatctcccgggcctcttccgctgcgagtgtgagattggctacgagctggac
cgaagtggagggaactgcacagatgttaatgagtgtctggatcctaccacctgcatcagt
gggaactgtgtcaacactccaggcagttacacatgcgactgtccacctgattttgagctg
aatccaactcgagtgggctgtgtcgatactcgctctggaaactgctatctggatatccgg
ccccggggagacaatggggatacggcctgcagcaatgaaattggagttggtgtttctaag
gcttcctgctgttgctctctgggtaaagcttggggaaccccatgtgagctgtgtcctcct
gtgaacacatccgagtataaaattctctgccccggaggagaaggttttcgtccaaatccc
atcaccgttatattggaagacatcgatgagtgccaggagctcccagggctgtgccaaggg
gggaagtgcatcaacacctttggcagcttccagtgtcgctgtccaacgggttactacctg
aatgaagacacacgggtgtgtgatgatgtgaacgaatgtgagactcccggaatctgtggt
ccggggacatgttacaacaccgttggcaactatacctgcatttgtcctccagactacatg
caagtgaatggggggaataattgcatggacatgagaagaagcctgtgctacagaaactat
catgctgacaaccagacctgcgatggagaactgctcttcaacatgaccaagaagatgtgt
tgctgctcctacaacatcggccgtgcctggaataagccctgtgaacagtgtcccatccca
agcacagatgaatttgctaccctctgtggaagccagaggccaggcttcgtgattgacatt
tacacaggtttacctgtggatattgatgaatgccgggagatcccaggggtttgtgaaaat
ggagtgtgcatcaacatggttggcagcttccggtgtgagtgccctgtgggattcttctac
aacgacaagttgctggtttgtgaagatatcgatgagtgtcagaatggccccgtgtgccag
cgcaatgcggagtgcatcaacaccgcaggcagctaccgctgtgactgcaaacccggctac
cgcctcacctccacgggtcaatgcaacgatcgaaacgagtgccaagaaatcccgaacata
tgcagtcatggccagtgcatcgacactgtgggaagcttctactgcctctgtcacacaggc
ttcaaaacaaacgcagatcagaccatgtgcttggacataaatgagtgtgagagagacgcc
tgtgggaatgggacttgcagaaacacaattggttccttcaactgccgctgcaaccatggc
ttcatactctctcacaacaatgactgcatagacgttgatgaatgtgcaactggaaacggg
aacctttgtagaaatggccagtgcgtcaacacggtggggtcctttcagtgcaggtgcaat
gaaggctacgaggtggctccagacggcaggacctgtgtggatatcaatgaatgtgttctg
gatcctgggaaatgtgcacctggaacctgtcagaacttggacggctcctacagatgcatt
tgcccacctgggtacagtctacagaatgacaaatgtgaagatattgatgagtgtgtcgaa
gagccagaaatctgtgctttggggacctgcagcaacactgaaggcagcttcaaatgtctg
tgtccagaagggttctccctgtcctctactggaagaaggtgccaagacttgagaatgagc
tactgctacgcgaagtttgaaggtgggaagtgttcgtcgcccaaatccaggaatcattcc
aagcaggaatgctgctgcgctttgaagggagaaggctggggagacccttgtgagttgtgt
cccactgagccagatgaggctttccgccagatatgcccctttggaagtgggatcatcgtg
ggccctgatgactcggcagttgatatggatgaatgcaaagaacctgatgtctgtaaacat
gggcagtgcatcaacacagacggctcctatcgctgcgagtgtccctttggttatattcta
gaagggaatgagtgtgtggataccgatgaatgctccgtgggcaatccttgtggaaatggg
acctgcaagaatgtgattggaggttttgaatgtacctgtgaggagggattcgagcctggt
ccaatgatgacatgtgaagatataaatgaatgtgcccagaatcccctactctgcgccttc
cgctgtgtaaatacctatgggtcctatgaatgcaagtgccctgttggatatgttctgcga
gaagacaggaggatgtgtaaagatgaggatgagtgtgcagaggggaagcacgactgtact
gaaaagcaaatggagtgcaagaacctcatcggtacctacatgtgcatctgcggcccaggg
taccagcgaagacctgatggagagggctgcatagatgagaatgaatgtcagaccaagcct
gggatctgtgagaacgggcgttgcctcaacaccctggggagctacacctgtgagtgtaat
gatggcttcacagccagccccactcaggatgagtgcttggacaaccgggaagggtactgc
ttttctgaggtactgcagaacatgtgccagattggatcaagcaacagaaaccccgtcacc
aagtccgagtgctgctgtgatggagggagaggctggggaccccactgtgagatctgcccc
ttcgagggcacagtggcttacaagaaactgtgtccccacggccgaggattcatgaccaac
ggagcagatattgatgagtgcaaggtaatccacgatgtttgccgaaacggggagtgtgtc
aatgacagaggatcatatcactgcatctgtaaaactggctacactccggacataacaggg
accgcctgtgtagatctaaatgagtgcaaccaggctcccaaaccctgcaatttcatatgc
aaaaacacagaagggagttaccagtgttcctgccccaagggctatattctgcaagaggat
ggaaggagctgcaaagatcttgacgagtgtgcaaccaagcagcataactgtcagttcctg
tgtgttaacaccatcggcggcttcacatgcaaatgccctcctgggttcacccagcaccac
actgcctgcattgataacaatgaatgcacttctgagatcaacctgtgtgggtccaagggc
gtttgccagaatacaccaggaagcttcacctgtgaatgccagcggggattctccctcgat
cagagtggtgccagctgtgaagatgtggacgagtgtgagggtaaccaccgctgccaacat
ggctgccagaacatcattggaggctataggtgcagctgcccccagggctacctccagcac
taccagtggaaccagtgtgtagacgaaaacgagtgcctgagtgcacatgtctgtggggga
gcctcctgccacaacaccctggggagttacaagtgcatgtgtcctgctggcttccagtac
gaacagttcagtggaggctgccaagatatcaacgagtgtggctcatcccaggccccctgc
agttatggttgctctaatactgagggtggctacctatgtggctgtcctccaggatacctc
cggataggccaagggcattgtgtttctggaatgggcatgggccgaggtggcccagagcca
cctgccagtggcgagatggatgacaactcactgtccccagaggcctgctatgagtgtaag
atcaatggctacccaaaacgaggcaggaaacggagaagcacgaatgaaacagatgcctct
gacatccaggatgggtctgaaatggaagccaacgtgagcctcgcgagctgggatgtggag
aagccagctagctttgctttcaatatttcccatatcaataacaaagtccgaatcctagag
ctcctgccggcccttacaactctgatgaaccacaacaaatacttgatcgagtctggaaat
gaagatggcttctttaaaatcaaccagaaagaaggggtcagctacctccacttcacgaag
aagaagccagtggctggaacctactccttacaaatcagcagtactccactttataaaaag
aaagaacttaaccagttagaagacagatatgacaaagactacctcagcggtgaactgggc
gataacctgaagatgaaaattcagatcttgctgcattaa

DBGET integrated database retrieval system