KEGG   Rattus norvegicus (rat): 84379
Entry
84379             CDS       T01003                                 

Gene name
Rab6a, RCO4-3, Rab6, Rab6b
Definition
(RefSeq) RAB6A, member RAS oncogene family
  KO
K07893  Ras-related protein Rab-6A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84379 (Rab6a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    84379 (Rab6a)
   04031 GTP-binding proteins [BR:rno04031]
    84379 (Rab6a)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    84379 (Rab6a)
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
    84379 (Rab6a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   84379 (Rab6a)
  Exosomal proteins of bladder cancer cells
   84379 (Rab6a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    84379 (Rab6a)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA CPT TetR_C_16
Other DBs
NCBI-GeneID: 84379
NCBI-ProteinID: NP_445818
RGD: 619737
Ensembl: ENSRNOG00000018176
UniProt: A0A0H2UHP9
Position
1q32
AA seq 208 aa
MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST
QDRSREDMIDIKLEKPQEQPVNEGGCSC
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctagga
gagcagagcgttggaaagacatccttgatcaccagattcatgtatgatagttttgacaac
acctatcaggcaacaattggcattgacttcttatcaaaaacaatgtacttggaggatcga
accatcaggctgcagctgtgggacactgcgggtcaggaacgtttccgtagcctcattccc
agttacatccgtgactctgctgcagccgtagtagtttacgatatcacaaatgttaactca
ttccagcagactacaaaatggattgatgatgtcagaacagaaagaggaagtgatgtcatc
atcatgctagtaggaaataaaacagatcttgctgataagaggcaagtgtcaattgaggag
ggagagaggaaagccaaagagctgaatgttatgtttattgaaaccagtgcaaaagcagga
tacaatgtaaagcagcttttccggcgtgtcgctgcagctttacctggaatggaaagcaca
caggacagaagcagagaagacatgattgacataaaactggaaaagcctcaggagcagcca
gtcaatgaaggtggctgttcctgctaa

DBGET integrated database retrieval system