KEGG   Rattus norvegicus (rat): 94197
Entry
94197             CDS       T01003                                 

Gene name
Rab14
Definition
(RefSeq) RAB14, member RAS oncogene family
  KO
K07881  Ras-related protein Rab-14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    94197 (Rab14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    94197 (Rab14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    94197 (Rab14)
   04031 GTP-binding proteins [BR:rno04031]
    94197 (Rab14)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    94197 (Rab14)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   94197 (Rab14)
  Exosomal proteins of other body fluids (saliva and urine)
   94197 (Rab14)
  Exosomal proteins of colorectal cancer cells
   94197 (Rab14)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    94197 (Rab14)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 Gtr1_RagA SRPRB DUF1863 Septin AAA AAA_22
Other DBs
NCBI-GeneID: 94197
NCBI-ProteinID: NP_446041
RGD: 620881
Ensembl: ENSRNOG00000018901
Vega: OTTRNOG00000002397
UniProt: P61107
Position
3p11
AA seq 215 aa
MATTPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI
KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII
LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGS
LDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcaactacaccgtacaactactcttacatctttaagtatattattatcggggatatg
ggagtaggaaaatcttgcttgcttcatcaatttacagaaaaaaagtttatggctgattgt
cctcacacaattggtgttgaatttggtacaagaataattgaagttagtggccaaaaaatc
aaactgcagatttgggatacagcaggacaggagaggttcagagctgttacacggagctac
tatagaggagctgcaggtgcgctcatggtgtatgacatcaccagaagaagtacatataac
cacttaagcagctggttgacagatgcaaggaacctcaccaacccaaacactgtaataatt
ctcataggaaataaagcagatttggaagcacagagagatgttacctatgaagaagccaaa
cagtttgctgaagaaaacggcttattgttccttgaagcaagtgcaaaaacgggagagaat
gtagaagatgcttttcttgaggctgccaagaaaatctatcagaacattcaggatggaagc
ctggatctgaatgctgccgagtctggtgtacaacacaaaccctcagccccgcagggagga
cggctaaccagtgaaccccaaccccagagagaaggctgtggctgctag

DBGET integrated database retrieval system