KEGG   Salvelinus alpinus (Arctic char): 111952428Help
Entry
111952428         CDS       T05762                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111952428
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:salp04812]
    111952428
   04147 Exosome [BR:salp04147]
    111952428
Membrane trafficking [BR:salp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    111952428
Cytoskeleton proteins [BR:salp04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     111952428
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111952428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras Gtr1_RagA AAA_16 FeoB_N AAA_22 Roc AAA_7 ABC_tran AAA_29 Fez1
Motif
Other DBs
NCBI-GeneID: 111952428
NCBI-ProteinID: XP_023826848
AA seq 430 aa AA seqDB search
MIERPESAVASIAQRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSL
FLTDLYSKDYPGPSLRIKKTVQVEQSKVLVKEGGVQLTLTIVDTPGFGDAVDNSNCWQPV
INYIDSKCEDFLNAESRVNRRLMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVI
PLIAKADTLTPEECHLFKKQIMKEIQEHKIQIYEFPDTEDDEDSKLIRKIKERMPLAVVG
SNVVIEVNGKKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYR
SRKLAAVTCNGGVDTSKTKNQMTRSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKK
QKLKDSEAELERRHEQMKKNLEAQYKELEEKKRHHEEEKSNWEAQQRILEQQKLEASKTM
EKNKKKGKIF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgaccagaatctgcagttgccagcattgcacagaggaatctggaggggtat
gtggggttcgccaacctcccaaaccaggtgtacaggaagtcagtgaagaggggctttgag
ttcacactaatggttgttggggagtctggattggggaaatccacgctcatcaactccctc
ttcctgactgacctgtactccaaggattacccagggccatccctacggatcaagaagact
gttcaggtggagcagtccaaggttctggtgaaggaagggggtgtccaactcacactcaca
atcgtcgatacaccagggttcggagatgcagtggataatagtaactgctggcagcctgtc
attaactacattgacagtaagtgtgaggacttcctgaatgcggagtcccgggtgaaccga
agactgatgccagacaaccgggttcactgctgcctgtacttcattgccccctctggccac
gggctgaagcccctggacattgagtttatgaagcgtctccatgacaaggtcaacgtgatc
cctctcatcgccaaggcagacaccctgacacctgaggaatgccacctattcaagaaacag
atcatgaaggaaatccaagaacacaagatccagatctatgagtttcctgacacagaggac
gatgaggacagcaagctcatccggaagatcaaggagcggatgcctctggcagtggttggc
agcaatgtggtgatcgaagtaaacggcaagaaggtcagaggtcgtcagtacccctggggc
gtggcagaagtggagaacggggagcactgtgactttactgtgttacggaacatgctgatc
aggacccatatgcaagatctgaaggatgtgaccaacaatgtccactatgagaactaccgg
agcaggaagcttgctgccgtcacctgcaatggaggagtggacaccagcaagaccaagaac
caaatgaccaggagccccctggcccagatggaggaggagcggagggaacatgtcatgaag
atgaagaagatggagactgagatggagcaggtgtttgagatgaaagtcaaggagaagaaa
cagaaactgaaggactctgaggccgagctggagcgacgccacgagcagatgaaaaagaac
ttggaggctcagtataaggaactggaggagaagaagcgccaccatgaggaagagaagtca
aactgggaggcacagcaacgtatactggagcagcagaaacttgaggcttctaagaccatg
gaaaagaacaaaaagaaaggaaaaatcttttaa

DBGET integrated database retrieval system