KEGG   Saccharomyces cerevisiae (budding yeast): YLR229CHelp
Entry
YLR229C           CDS       T00005                                 

Gene name
CDC42
Definition
(RefSeq) Rho family GTPase CDC42
  KO
K04393  cell division control protein 42
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04144  Endocytosis
sce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR229C (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YLR229C (CDC42)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    YLR229C (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YLR229C (CDC42)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR229C (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR229C (CDC42)
   04031 GTP-binding proteins [BR:sce04031]
    YLR229C (CDC42)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    YLR229C (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    YLR229C (CDC42)
  Macropinocytosis
   Ras GTPases
    YLR229C (CDC42)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    YLR229C (CDC42)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   YLR229C (CDC42)
  Exosomal proteins of breast milk
   YLR229C (CDC42)
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    YLR229C (CDC42)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 850930
NCBI-ProteinID: NP_013330
SGD: S000004219
UniProt: P19073
Position
XII:complement(604212..604787)
Genome map
AA seq 191 aa AA seqDB search
MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAG
QEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLR
DDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPP
VIKKSKKCAIL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctaaagtgtgttgttgtcggtgatggtgctgttgggaaaacgtgccttcta
atctcctatacaacgaatcaatttccagccgactatgttccaacagtgttcgataactat
gcggtgactgtgatgattggtgatgaaccatatacgttaggtttgtttgatacggccggt
caagaagattacgatcgattgagacccttgtcatatccttctactgatgtatttttggtt
tgtttcagtgttatttccccaccctcttttgaaaacgttaaagaaaaatggttccctgaa
gtacatcaccattgtccaggtgtaccatgcctggtcgtcggtacgcagattgatctaagg
gatgacaaggtaatcatcgagaagttgcaaagacaaagattacgtccgattacatcagaa
caaggttccaggttagcaagagaactgaaagcagtaaaatatgtcgagtgttcggcacta
acacaacgcggtttgaagaatgtattcgatgaagctatcgtggccgccttggagcctcct
gttatcaagaaaagtaaaaaatgtgcaattttgtag

DBGET integrated database retrieval system