KEGG   Saccharomyces cerevisiae (budding yeast): YNL290WHelp
Entry
YNL290W           CDS       T00005                                 

Gene name
RFC3
Definition
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Module
sce_M00289  RF-C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YNL290W (RFC3)
   03420 Nucleotide excision repair
    YNL290W (RFC3)
   03430 Mismatch repair
    YNL290W (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL290W (RFC3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL290W (RFC3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL290W (RFC3)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    YNL290W (RFC3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     YNL290W (RFC3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YNL290W (RFC3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     YNL290W (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    YNL290W (RFC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA DNA_pol3_delta2 Rep_fac_C Rad17 DNA_pol3_delta AAA_assoc_2 RuvB_N AAA_16 AAA_14 AAA_22 AAA_11 DUF815 ResIII AAA_30 AAA_7 AAA_5 AAA_24 IstB_IS21 DEAD AAA_19 AAA_18 Viral_helicase1 AAA_3 AAA_25 Mg_chelatase TIP49 RNA_helicase AAA_28 SNF2_N DUF2075 TniB Methyltransf_31 BET
Motif
Other DBs
NCBI-GeneID: 855426
NCBI-ProteinID: NP_014109
SGD: S000005234
UniProt: P38629
Structure
PDB: 

Position
XIV:86218..87240
Genome map
AA seq 340 aa AA seqDB search
MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKT
STIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEAD
AMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIAN
VLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPR
PSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLL
TKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaagtacagagaagaggagcaaagaaaaccttccatgggttgaaaaatacaga
cccgaaacgttggacgaagtgtacggacaaaatgaggtgatcaccacagttcgtaaattt
gtagatgaaggtaaattgccacatcttctattctatgggcctccaggtaccggtaaaact
tctacaattgttgctttggcacgtgagatatatggtaagaattactcgaacatggttttg
gagctgaatgcatccgatgacagaggtattgatgtggtgaggaatcaaattaaagacttt
gcctctacaagacaaatcttctctaaagggttcaagttaattatactggatgaagcagat
gccatgaccaatgccgcacaaaatgcgttgagaagagttatagaacggtacaccaagaat
acgcggttctgtgtattggccaattatgcgcataaacttacacctgcgttattgagtagg
tgcacgagattcagatttcagcccttgccccaagaggccattgagcgtcggatagccaac
gtcttggtgcatgagaagctgaagttgtctcctaatgcggagaaggccttaatagaactt
tctaatggggatatgagacgtgtgttaaacgttttgcagtcttgcaaagctactttagac
aatcccgacgaggatgagatcagtgacgacgttatctatgaatgctgtggggcacccaga
ccaagtgacttaaaggcagtattgaagtcgatactggaggacgattggggtaccgcccac
tacacacttaataaggtacgcagtgccaagggtctcgcgttgatcgacctaatcgagggc
atagtgaagatactggaagactacgaacttcaaaatgaggaaacaagagtgcatttgctt
accaaactggccgatatagagtactcgatatccaagggtggcaacgaccagattcagggc
agcgcggtcattggcgccatcaaggccagcttcgagaacgaaactgttaaagccaacgta
taa

DBGET integrated database retrieval system