KEGG   Saccharomyces cerevisiae (budding yeast): YOR089CHelp
Entry
YOR089C           CDS       T00005                                 

Gene name
VPS21, VPS12, VPT12, YPT21, YPT51
Definition
(RefSeq) Rab family GTPase VPS21
  KO
K07889  Ras-related protein Rab-5C
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YOR089C (VPS21)
   04145 Phagosome
    YOR089C (VPS21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YOR089C (VPS21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YOR089C (VPS21)
   04031 GTP-binding proteins [BR:sce04031]
    YOR089C (VPS21)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    YOR089C (VPS21)
 Endosome - Lysosome transport
    YOR089C (VPS21)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YOR089C (VPS21)
  Exosomal proteins of other body fluids (saliva and urine)
   YOR089C (VPS21)
  Exosomal proteins of colorectal cancer cells
   YOR089C (VPS21)
  Exosomal proteins of bladder cancer cells
   YOR089C (VPS21)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    YOR089C (VPS21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-GeneID: 854256
NCBI-ProteinID: NP_014732
SGD: S000005615
UniProt: P36017
Structure
PDB: 

Position
XV:complement(490196..490828)
Genome map
AA seq 210 aa AA seqDB search
MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEI
WDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGN
KIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQN
SASNERESNNQRVDLNAANDGTSANSACSC
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatcagtcacttccataaagttggtactgttgggtgaggcagcagttggtaaa
tcgtcaatagtcctaaggtttgtatctaatgattttgccgaaaataaggagcccaccatt
ggtgcagcattcctcactcaaagagttactataaatgaacatactgttaagtttgaaata
tgggacactgctgggcaagagagatttgcatctttagcacctatgtactatagaaacgca
caagctgctcttgtagtatacgacgttacaaaaccacaatcctttattaaagcgcgccac
tgggttaaggaattacatgaacaggcatcaaaggatatcatcattgcgttagttggtaac
aagatcgatatgctgcaagaaggtggggaaagaaaagtcgcaagggaagaaggtgaaaag
ctagcggaagaaaagggcttgttgttctttgaaacaagtgcaaagacaggagagaatgtt
aacgatgtatttttgggaatcggtgaaaagataccactgaagacggctgaagagcaaaat
agtgcaagtaacgaacgtgagtcgaacaatcaaagagtggatttgaacgctgctaatgat
gggaccagcgcaaacagtgcttgcagttgttag

DBGET integrated database retrieval system