KEGG   Saccharomyces cerevisiae (budding yeast): YPL051W
Entry
YPL051W           CDS       T00005                                 

Gene name
ARL3
Definition
(RefSeq) Arf family GTPase ARL3
  KO
K07952  ADP-ribosylation factor related protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPL051W (ARL3)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sce04031]
    YPL051W (ARL3)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    YPL051W (ARL3)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arp
    YPL051W (ARL3)
SSDB
Motif
Pfam: Arf Ras SRPRB Roc G-alpha MMR_HSR1 GTP_EFTU Gtr1_RagA AAA_18 AAA_22 AAA_24 Thymidylate_kin DUF4412
Other DBs
NCBI-GeneID: 856056
NCBI-ProteinID: NP_015274
SGD: S000005972
UniProt: Q02804
Position
XVI:459963..460559
AA seq 198 aa
MFHLVKGLYNNWNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVA
TIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMD
EEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIE
WMIVRLERNKKSRPPIYK
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtttcatttagtcaagggactttacaataattggaataaaaaggaacaatattcaatt
ctaatattaggtctagacaatgcaggcaaaacgacgttcttggagacattgaaaaaggaa
tactctctggcgttcaaagccttggaaaagatacagcctacggtaggacaaaatgtggcg
acaatacccgttgacagtaaacagatcttgaagttttgggatgtaggtggtcaagaatca
ctgagatcaatgtggtccgaatactattccctatgtcatggtataattttcattgtggat
agttcagatagagaacgattagacgaatgttccacgaccctacagtcagttgtaatggat
gaagaaattgaaggtgtacccatcttgatgctggccaataaacaagatagacaagataga
atggaagtacaagatataaaagaagtatttaataagattgcggaacatataagcgctaga
gatagtagggttttaccaataagcgcattgactggagaaggtgttaaagacgctatagaa
tggatgattgttagactagaaaggaataaaaagtcaagaccaccgatttataaatga

DBGET integrated database retrieval system