KEGG   Schizosaccharomyces pombe (fission yeast): SPAC27E2.10c
Entry
SPAC27E2.10c      CDS       T00076                                 
Symbol
rfc3
Name
(RefSeq) DNA replication factor C complex subunit Rfc3
  KO
K10756  replication factor C subunit 3/5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPAC27E2.10c (rfc3)
   03420 Nucleotide excision repair
    SPAC27E2.10c (rfc3)
   03430 Mismatch repair
    SPAC27E2.10c (rfc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPAC27E2.10c (rfc3)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC27E2.10c (rfc3)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC27E2.10c (rfc3)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    SPAC27E2.10c (rfc3)
  DNA Replication Termination Factors
   ELG1-RFC complex
    SPAC27E2.10c (rfc3)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    SPAC27E2.10c (rfc3)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     SPAC27E2.10c (rfc3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    SPAC27E2.10c (rfc3)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_assoc_2 DUF815 AAA_16 AAA_11 RuvB_N AAA_19 AAA_14 AAA_22 AAA_30 DNA_pol3_delta AAA_24 TniB AAA_7 ResIII DEAD Mg_chelatase AAA_5 AAA_3 bpMoxR Viral_helicase1 DUF6570 RecR ATPase_2
Other DBs
NCBI-GeneID: 2541493
NCBI-ProteinID: NP_001342879
PomBase: SPAC27E2.10c
Ensembl: SPAC27E2.10c
Position
I:complement(4034145..4035920)
AA seq 342 aa
MSIEKGKGRAMDIDLPLGSESTLPWVEKYRPANLEDVVSHKDIISTLEKFISSNRVPHML
FYGPPGTGKTSTILACARKIYGPNYRNQLMELNASDDRGIDAVREQIKNFASTRQIFAST
FKMIILDEADAMTLAAQNALRRVIEKYTKNVRFCIICNYINKISPAIQSRCTRFRFQPLP
PKEIEKTVDHVIQSEHCNIDPDAKMAVLRLSKGDMRKALNILQACHAAYDHIDVSAIYNC
VGHPHPSDIDYFLKSIMNDEFVIAFNTISSIKQQKGLALQDILTCIFEALDELEIKPNAK
IFILDQLATIEHRMSFGCSEKIQLSAMIASIKTGVDLAAKVN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtctatcgaaaaaggtaaagggcgtgcaatggacattgaccttcctttgggaagtgag
agtacgctcccatgggtggaaaagtaccgaccagctaatttagaggatgtggtttctcac
aaagatatcatatctacgcttgaaaaattcattagttcaaatagagtccctcatatgctg
ttttatgggccacctggcacaggcaaaacctctacaattcttgcgtgtgctcgaaaaatt
tatggaccaaattacagaaatcagttgatggagttaaatgcaagcgatgatcgtggtatc
gatgccgtgagggaacaaatcaaaaattttgccagcacccggcaaatctttgcatctact
ttcaaaatgattatattagatgaagccgatgccatgactttggcggctcaaaatgcttta
cgaagagtaattgaaaaatatactaagaacgttcgtttttgcattatctgtaactatatc
aacaaaatatctcctgctattcaatctagatgtaccaggtttcgcttccagcctttaccg
cccaaagagatagaaaaaacggttgatcatgttattcaaagcgaacattgtaatattgac
cctgatgcaaagatggccgtattaaggctttccaaaggagatatgaggaaagcactgaat
atactccaggcgtgccatgctgcctacgatcatattgatgtatctgctatctataattgt
gtaggccatcctcacccttccgatattgattattttttgaaatctatcatgaatgatgaa
ttcgtaatcgctttcaataccattagctcaatcaaacagcaaaagggtttggccttgcaa
gacattttgacatgtatctttgaagcactagacgagcttgaaataaaaccaaatgctaaa
atttttattctggatcagcttgcaacgattgaacatcgaatgtcttttggatgttctgaa
aaaatacagctttcagcaatgatagcgagcattaaaactggtgttgatttagcagcaaag
gtaaattga

DBGET integrated database retrieval system