KEGG   Sus scrofa (pig): 100144497Help
Entry
100144497         CDS       T01009                                 

Gene name
RAB28
Definition
(RefSeq) ras-related protein Rab-28
  KO
K07915  Ras-related protein Rab-28
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ssc04031]
    100144497 (RAB28)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab28
    100144497 (RAB28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA PduV-EutP G-alpha DLIC
Motif
Other DBs
NCBI-GeneID: 100144497
NCBI-ProteinID: NP_001116647
UniProt: A0A4X1SG54 A0A287BHN2 Q06AU1
Position
8
AA seq 221 aa AA seqDB search
MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNL
NVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNHQSFENLEDWYSVVKKVSEESET
QPLVALVGNKIDLEHMRTVKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGI
KLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactccgaggaggagagccaggaccggcaactgaaaatcgtcgtgctgggggac
ggcacctccgggaagacctccttagctacgtgttttgctcaagaaacttttgggaaacag
tacaaacaaactataggactggatttctttttgagaaggataacattgccaggaaacttg
aatgttactcttcaagtttgggacataggaggacagacaattggaggcaaaatgctggat
aaatatatctatggagcacagggaatccttttggtatatgatattacaaatcatcaaagc
tttgagaacttagaagattggtattctgtggtgaagaaagtgagtgaggagtcggaaact
cagccactggttgccttggtgggcaataaaattgatttggagcatatgcgaacagtaaaa
cctgaaaaacacttaaggttttgccaggaaaatggttttagtagccactttgtctcagca
aagacaggagactctgtcttcctgtgttttcagaaagttgctgctgaaatccttggaatc
aagttaaacaaagcagaaatagaacagtcgcagagggtggtgaaggcagatattgtaaac
tacaaccaggaacctatgtcaagaactgttaaccctcctagaagctctatgtgtgcagtt
cagtga

DBGET integrated database retrieval system