KEGG   Tolumonas auensis: Tola_2444
Entry
Tola_2444         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_22 AIG1 T2SSE ATPase_2 TrwB_AAD_bind AAA_7 AAA_10 DUF87 AAA_16
Other DBs
NCBI-ProteinID: ACQ94039
UniProt: C4L9T6
Position
2667249..2670125
AA seq 958 aa
MAWSLPWRRRAPNDAAQIDDRQDGWTRHVRALREAGIPEPGEAVAPSRPATVADEQALYD
AAPSFVALLPWVEYLPDSQCMLLEDGVSVAAFFELTPLGTEGREAAWLARARDALENALQ
DSFDELDANPWVLQLYAQDEANFDQYLDTLRGYVQPRAEGSRFTEFYLTSFAHHLRAVAK
SGGLFEDTAVTRLPWRGQSRRVRMVVYRRAAGQTGRRGQTPEQALNVVCDRLIGGLSNAG
IQTRRLDAPQIHDWLLRWFNPRPTMLGPTAQDRERFYRLAAYPEAPESDEIELASGKDFS
QRLFFGQPRSDAELGLWYFDSLPHRVMVTDRLRMPPATGHLTGETRKGDAINTLFDQLPE
GTVMCLTLVATPQDILEAHLNQLAKKSVGETLASEQALQDVQEARSLIGSSHKLYRGSLA
FYLSGDDEDELDRRGLQLANVMLNAGLQPVREEDEVAPLNSYLRWLPCVYNPGADRKQWY
TQLMFAQHAANLSPAWGRSQGTGRPGITLFNRGGGVLTFDPFSRLDRQMNAHLFLFGPTG
SGKSATLNNILNQVAAIYRPRMFIVEAGNSFGLLADFAARLGLSVNRVKLAPGSGVSLAP
FADARRLIESPSDVQTLDADALDEEQPVDPAAVDTDEQRDVLGELEITARLMITGGEDKE
ESRMTRADRSLIRQCILDAARHCVAQDRDVLTRDVRDALRERGRDSTLPETRRTRLLEMA
DAMDIFTQGSDGEMFDRPGTPWPEADITVVDLATYAREGYNAQLSIAYISLINTVNNIAE
RDQFLGRPILNVTDEGHIITRNPLLSPYVVKITKMWRKLGAWYWLATQNIDDLPRAAEPM
LNMIEWWLCLSMPPDEVEKIARFRELSPAQKALMLSARKESGKFSEGVILSKSMEVLFRA
VPPSLYLALAQTEPEEKAERYRLMQQFGINELEAALKVSENIDRARGIEPLPYADLLS
NT seq 2877 nt   +upstreamnt  +downstreamnt
atggcctggtcgttgccctggcgccggcgggcacctaacgatgcggcgcagatcgatgac
cggcaggatggctggacgcgccatgtacgcgcgctgcgcgaggccggcattcccgaaccc
ggcgaggcggtcgcgcccagccgcccggccacggtggccgatgagcaggcactgtacgat
gcggcaccgtcattcgtcgcgctgctgccgtgggttgagtacctgccggattcgcagtgc
atgctgcttgaggatggcgtctcggttgccgcctttttcgagctgacgccgctgggcact
gaaggtcgcgaggccgcctggctggcacgggcacgcgatgcgttggaaaacgccttgcag
gacagcttcgacgagctcgatgcgaatccatgggtgctccagctctacgcccaggacgag
gccaactttgaccagtacctggacacgctgcgcggctacgttcagccgcgtgccgagggt
agccgcttcacggagttctacctgacctcgttcgcccaccatctccgcgccgttgccaaa
tccggcgggctgttcgaggacacggctgtcacacgcctgccgtggcgcggtcagagccgg
cgcgtgcggatggtggtctatcgccgcgctgcgggccagaccggccgccgcggccagaca
cccgagcaggcgctgaacgtcgtgtgcgaccgcctgattggcggcctgtccaacgcgggt
atccagacgcgccggctggatgcgccgcagatccatgactggctgctgcgttggttcaat
ccccggcccaccatgctcgggccgacggcgcaggatcgcgaacgcttctaccggctggcg
gcctatccggaggcaccggaatctgatgagatcgaactcgccagcggcaaggatttctcg
cagaggttgttcttcggccagccgcgctccgacgccgagctggggttgtggtacttcgat
agcctgccgcaccgggtcatggtcaccgaccgcctgcgcatgccgccggccaccggccat
ctcaccggcgaaacgcgtaagggcgacgcgatcaacacgctgttcgaccagctgcccgaa
ggcaccgtgatgtgcctgacgctggttgcgacgccgcaggacatcctggaagcgcacctc
aaccaactggcgaagaagtcagtcggagaaaccctggcgtccgagcaggcgctccaggac
gtgcaggaggcgcgttcgctgatcggcagctctcacaagctgtatcgcggctcgctggcg
ttctacctctccggcgacgacgaagacgaactggaccggcgcggcctgcagctcgccaac
gtgatgctcaacgccgggctgcagccagtccgcgaagaagacgaagtcgcgccgctcaac
agctatctgcgctggctgccttgcgtctacaaccccggcgcggaccgcaagcagtggtac
acgcaactgatgttcgctcagcatgccgccaatctgtcgccggcatggggacgcagccag
ggtacgggcaggcccggcatcacgctgttcaatcgcggtggcggagtactgacgttcgac
ccgttcagcagattggatcggcaaatgaatgcccatttgtttttgtttgggccaacgggt
tcgggcaagtcggccacgcttaacaacatcctcaaccaggtcgccgcgatctaccgcccg
cgcatgttcatcgtggaggccggtaattcctttggcttgctggctgatttcgccgcacgg
ctgggcctgtcggtgaaccgggtcaagctcgcgcccggttcgggcgtgagcctcgcgccg
ttcgccgatgcccgccggttgatcgaatcccccagtgatgtgcagacgctggacgccgat
gcgctggatgaggaacagcctgtcgacccggccgccgtcgatacggacgagcagcgcgat
gtgctcggcgagcttgagatcaccgcacgcttgatgatcacgggcggcgaagataaagag
gaatcccgcatgacgcgggccgaccgctccttgatccgccagtgcatcctggacgccgcc
cgccactgcgtcgcgcaagaccgggatgtgctcacgcgcgacgtgcgcgacgccctacgc
gagcgcggccgcgattcgaccctgcccgaaacccgtcgcacgcggttgttggagatggct
gacgctatggacatcttcacgcaaggctcagacggcgaaatgttcgaccgccccggcacg
ccctggccagaagccgacatcacggtcgtcgatctcgccacctatgccagggagggctac
aacgcccagctctcgatcgcctacatctccctgatcaataccgtcaacaacattgcggaa
cgcgaccagtttctcggtcggccaatcctcaacgtgaccgatgaaggccacatcatcacg
cgcaatcccttgttgtctccgtacgtggtgaagatcaccaagatgtggagaaaattgggc
gcctggtattggttggcaacgcagaacatcgacgatctgcccagggcggcggagccgatg
ctcaatatgatcgagtggtggttgtgcttgtcgatgccaccggacgaagtcgaaaaaatt
gccaggttccgcgagttgtcgccagcgcagaaggcactgatgctctcggccaggaaggaa
tccgggaagttcagcgagggcgtcattctctccaagagcatggaggtgctgttcagggcc
gtaccaccgagcttgtatctcgcactggcccagaccgaacccgaagagaaagccgaacga
taccggctcatgcaacagttcggcatcaacgagctggaagccgcgctcaaggtatccgag
aacatcgaccgcgcgcgcggcatcgagccgttgccatacgccgatctgctctcctga

DBGET integrated database retrieval system