KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_2859
Entry
Tgr7_2859         CDS       T00840                                 
Name
(GenBank) AAA ATPase
Organism
tgr  Thioalkalivibrio sulfidiphilus
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE P-loop_TraG AAA_22 AAA_10 EccE DUF4913 DUF87 AAA_16 AIG1 ATPase_2 T2SSE TrwB_AAD_bind AAA_7 Pox_A32
Other DBs
NCBI-ProteinID: ACL73932
UniProt: B8GNP1
Position
2998441..3001323
AA seq 960 aa
MAWSLPWPRKPVSASEESEAQQADAWQRHVAGLKAHGIPEPGTRLDPKHRPATQADEQAL
YDVAPSFVDLLPWVEYLADAKSLLLEDGESVAAFFELTPIGTEGRESDWLWQARDALENA
LQDSFDELDEQPWVVQLYAQDEADWTDYLNVLRDYIQPRAQGSAFSDFYLRFFAHHLRAI
TKPGGLFDDTTVTHLPWRGQTRRVRMVVYRRTPGASHRRGQSPEQALATVCDRLAGGLAN
AGVKARRLGAADIHAWLLRWFNPNPTLLGATAADRERFYQLAAYPEEANEGDVELASGTD
FSQRLFFGQPRSDVANGIWFFDDMPHRVMVLDRLRTPPTTGHLTGETRKGGDACNALFDQ
MPEDTVMCLTLVATPQDALEAHLNYLGKKAVGETLASEQARQDVQQARSLIGSSHKLYRG
ALAFYLRGRDMAELDARGLQLANVMLNAGLLPVREEDEVAPLNSYLRWLPCLYDPARDRR
QWYTQLMFAQHAANLTPVWGRNQGTGNPGITFFNRGGGTVAFDPLNRRDRQMNAHLFLFG
PTGSGKSATLNNILNQLVAIYRPRLFIVEAGNSFGLFGEFAQRLGLTVHRVKLAPGAGVS
LAPFADAWRLVDTPSQVRTLDADALDEEQEPEDASSESDEQRDVLGELEITARLMITGGE
DKEEARMTRADRSLIRQCILDAAHRCAPEKRTVLTEDVRNALRERASDSALPEARRARLL
EMADAMDMFCQGLDGEMFNRPGTPWPEADITIVDLATFAREGYNAQLSIAYISLINTVNN
IAERDQFLGRPIVNVTDEGHIITRNPLLAPYVVKITKMWRKLGAWFWLATQNLDDLPKAA
EPMLSMIEWWICLSMPPDEVEKVARFRELNPAQKALILSARKESGKFSEGVILSKSMEVL
FRAVPPSLYLAMAMTEPEEKAERYQLMRQHGIGELEAAFKVAEKIDRARGIEPLPLDALG
NT seq 2883 nt   +upstreamnt  +downstreamnt
atggcgtggtcgctgccgtggccgcgcaaacctgtgtcggcatccgaggaatccgaggca
cagcaggccgacgcctggcaacgccatgtggccggcctgaaagcgcatggcattcccgag
cccggcacccgcctcgatccgaaacaccggcccgccacgcaggcggatgaacaggccctc
tacgacgtggcgccgtccttcgtggacctgttgccgtgggtggaatatctggccgacgcc
aagagcctgttgctggaggatggtgaatcggtggcggcgttctttgagctgacaccgatc
ggcaccgaaggacgcgaaagcgattggctgtggcaggcccgagacgcgctggagaatgcc
ctacaggacagcttcgacgaactcgacgagcaaccctgggtggtgcagctctatgcccag
gacgaagccgactggacggactatctgaacgtattgcgggactacatccagccgcgcgcg
cagggcagcgcgttcagcgacttctacctgcggttcttcgcgcatcacctgcgggccatc
accaagccgggcggcctgttcgacgacaccaccgtgacccacctgccgtggcgcggccag
acgcggcgcgtgcgcatggtggtctatcgtcgcacgccgggcgcttcacaccgtcgcggc
caatcgcccgaacaggccctggcgacggtatgcgaccggctggccggcggtctcgccaat
gcgggcgtcaaggcgcggcgcctgggcgcggcggacatccacgcctggttgctgcgctgg
ttcaacccgaacccgaccttgctaggcgcgacggctgccgatcgtgaacgcttctaccag
ttggccgcctaccccgaagaagcaaacgaaggcgacgtcgaactcgccagcggcacggac
ttctcgcaacggctgttcttcggccagccacgctccgacgtggcgaacggcatctggttt
ttcgacgacatgccgcatcgggtcatggtgctcgaccggctgcgcacaccgccgacaacc
ggacacctgaccggggaaacacgcaaaggcggcgatgcctgcaacgcgctgttcgaccag
atgcccgaggacacggtgatgtgtctcaccctcgtcgccacgccacaggacgcactggaa
gcacatctgaactacctgggcaagaaagcggtcggcgaaacgctggcgtccgagcaggcc
cggcaggacgtgcagcaggcacgttcgctgatcggcagttcgcacaagctctatcgcggc
gcgctggccttctacctgcgcgggcgcgacatggccgaacttgacgcgcgcggcctgcaa
ctcgccaacgtcatgctcaacgccggcctcctgcccgtgcgcgaagaggatgaggtcgcg
ccgctcaacagctatctgcgctggcttccctgcctctatgacccggccagggatcgacgc
cagtggtacacccagctcatgttcgcgcagcacgcggcgaatctcacgcccgtgtggggg
cgcaatcagggcaccgggaaccccggcatcaccttcttcaatcgcggtggcggcaccgtc
gccttcgacccgctcaaccggcgcgaccggcagatgaatgcccatctgtttctgttcggc
ccgaccggctcgggcaaatcggccacgctcaacaacatcctcaaccagctcgtcgcgatc
taccggccccggctgttcatcgtcgaggcggggaacagcttcggtctgtttggcgaattc
gcccagcgccttggcctgacggtgcatcgggtgaagctcgcgcccggcgctggcgtgagc
ctcgcgccctttgccgatgcgtggcgtctggtggatacgcccagccaggtgcggacgctg
gacgccgatgccctggacgaggaacaggaacccgaagacgcatcgagcgaaagcgatgaa
cagcgcgacgtgctcggcgagttggagatcaccgcccgcctgatgattaccggcggcgag
gacaaggaagaggcgcgcatgacccgcgccgatcgcagcctgatccgccagtgcattctc
gacgcggcgcatcgctgtgcgccggagaagcgcacggtgctgaccgaggacgtgcgcaac
gccctgcgcgagcgcgccagcgattccgcgctgccagaagcccggcgcgctcgcctgctg
gaaatggcggacgcgatggatatgttttgccagggcctggatggggaaatgttcaatcgt
cccggcacgccatggccggaagccgacatcaccatcgtcgatctggcgaccttcgcgcgc
gagggctacaacgcgcagctttccatcgcctatatctcgctcatcaacaccgtcaacaac
atcgccgagcgggatcaattcctggggcgccccatcgtcaacgtcactgacgagggtcac
atcatcacccgcaatccattgcttgccccttacgtcgtcaagatcaccaagatgtggcgc
aagctcggcgcctggttctggctggcgacgcagaacctggacgatctgcccaaggccgcc
gaaccgatgctgtcgatgatcgagtggtggatctgcctgtcgatgccacccgacgaagtg
gagaaggtcgcgcgcttccgcgaactcaatccggcacagaaggcgctgatactgtcggcg
cgcaaggagtccggcaagttcagcgaaggcgtgatcctgtcgaagtcgatggaagtcctg
ttccgcgccgtgccgccgagtctctacctggccatggcgatgaccgagcccgaggagaag
gccgagcgctatcagttgatgcggcaacacggcatcggtgagctggaggccgctttcaag
gtcgcggagaaaatcgaccgggcacgcggcatcgagccattgccgctcgacgccctcggt
tga

DBGET integrated database retrieval system