KEGG   Candidatus Accumulibacter regalis: CAP2UW1_4732
Entry
CAP2UW1_4732      CDS       T00966                                 
Name
(GenBank) hypothetical protein
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
app  Candidatus Accumulibacter regalis
Pathway
app02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:app00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CAP2UW1_4732
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:app02044]
    CAP2UW1_4732
Enzymes [BR:app01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     CAP2UW1_4732
Secretion system [BR:app02044]
 Type IV secretion system
  Trb secretion system protein
   CAP2UW1_4732
SSDB
Motif
Pfam: T2SSE FtsK_SpoIIIE AAA_19 AAA_29 DUF87 AAA_16 AAA_7 ResIII DEAD nSTAND3 Bac_DnaA GTP_EFTU TrwB_AAD_bind P-loop_TraG Mg_chelatase AAA_23 PduV-EutP ABC_tran TsaE AAA_30 NACHT ATP_bind_1 RsgA_GTPase PhoH AAA_22 cobW UvrD-helicase ABC_ATPase AAA_10 ATP-synt_ab AAA_28 ATPase_2 Septin MMR_HSR1 Sigma54_activat Pox_A32 Dynamin_N nSTAND1 AAA IstB_IS21 Zeta_toxin DUF815 ATPase G-alpha DLIC AAA_21
Other DBs
NCBI-ProteinID: ACV37854
UniProt: C7RW44
Position
pAph01:complement(163107..164069)
AA seq 320 aa
MAEIEESVSSLKERAKRKLERDLGSLLMDALADPRTVEMMLNADGRLWQERLGEKMHCIG
SISFARAEAIIKTVAGYHSKEVTRHKPILEGELPIDGSRFAGQLPPVVPAPTFAIRKKAV
AIFTLDQYVEAGIMTAAQQATLTAAIKAHRNILVIGGTGSGKTTLVNAIINAMVEFDPAE
RVFIIEDTGEIQCAAENFVQYHTSLEVTMTMLLKTTLRMRPDRILVGEVRGPEALDLLMA
WNTGHEGGAATLHANNARSGLDRLAMLISMHPESPRPIEPLIGEAVHVIVHIARTPEGRC
VQEILEVAGYANGAYLTRPL
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcagaaatcgaagagtccgtttcctccctcaaggaacgggcgaagaggaagctggag
cgtgatctggggtcgctcctgatggacgccctggccgaccccaggaccgtcgagatgatg
ctcaatgccgacggcaggctgtggcaggagcggctgggcgagaagatgcactgcattggc
agcatttccttcgcgcgcgccgaagcgatcatcaagaccgttgccggctatcacagcaag
gaagtgacgcggcacaagccgattctcgaaggcgaactgccgattgatggctcgcgcttc
gccggccagcttccgccggtcgttcccgcgccaactttcgccatccgcaagaaggccgtg
gcgatattcacgctcgaccagtacgtcgaggctgggatcatgaccgctgcgcagcaggcg
accctgacggccgccatcaaggcgcaccggaacatcctggtgatcggtggcaccggttcc
ggcaagaccacgctggtcaacgcgatcatcaacgccatggtcgagttcgatcccgccgag
cgcgttttcatcatcgaggacaccggcgagatccagtgtgccgccgagaacttcgtgcag
taccacacctcgctcgaagtcacgatgaccatgcttctcaagaccaccctgcgcatgcgg
cccgaccggatactggtcggcgaagtacgcggccccgaagcgctggacctgctgatggcc
tggaacactggccacgaaggcggtgcggccacgctccacgccaacaatgcccggtccggg
cttgaccgcctcgccatgctgatcagcatgcacccggaatcaccgcggccgatcgaaccg
ctgatcggcgaagcggtgcacgtcatcgtccatatcgctcgcacccccgaaggccgctgc
gttcaggagatcctggaagtggccggctacgccaacggcgcttacctcactcgtcctctg
taa

DBGET integrated database retrieval system