KEGG   Brucella abortus S19: BAbS19_II00530Help
Entry
BAbS19_II00530    CDS       T00703                                 

Definition
(GenBank) type IV secretion system protein VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
bmc  Brucella abortus S19
Pathway
bmc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BAbS19_II00530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmc02044]
    BAbS19_II00530
Enzymes [BR:bmc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BAbS19_II00530
Secretion system [BR:bmc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BAbS19_II00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE NACHT ABC_tran AAA_7 AAA_22 Zeta_toxin AAA_16 TsaE RsgA_GTPase DUF87 AAA_29 AAA_23 AAA_18 cobW AAA_30 FtsK_SpoIIIE TrwB_AAD_bind dNK AAA_33 AAA RNA_helicase PduV-EutP DUF2075 Septin Sigma54_activat AAA_21 MMR_HSR1 MobB NB-ARC CEBP_ZZ AAA_24 Roc ATPase_2 Viral_helicase1 Pox_A32 ATP_bind_1 PRK AAA_28 AAA_14 Ploopntkinase3 ResIII
Motif
Other DBs
NCBI-ProteinID: ACD73580
UniProt: A0A0F6ATE5
Position
2:complement(56646..57731)
Genome map
AA seq 361 aa AA seqDB search
MSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYA
VPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRK
PSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVA
GETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPSEAKEEENAPVTA
ATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGGSITSCHAGSCELTFERLALMVL
QNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKRALSLQHSEKT
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccgaagtgactttattgtgcctgacgaggcggctgtcaaacgggcggcctcg
gtcaatttccatctggaaccgctacgcccttggttggacgatccgcagatcaccgaagtt
tgcgtgaaccggccgggcgaagtgttctgcgagcgagcaagcgcgtgggaatactatgcg
gtgccaaacctcgactatgaacacctgatttcgctgggaaccgccaccgcgcggtttgtg
gatcaggatatttcggacagccgaccggtgctgtctgcgatcctgccgatgggtgagcgc
attcagattgtgcgcccgcccgcatgtgagcacggcaccatctcggtgacgatccgcaag
ccgtctttcacccggcgcacactggaagactatgcgcagcagggctttttcaaacacgtc
agacccatgagtaagagcctgacgccgtttgaacaggaactgctcgcattgaaggaagct
ggtgattacatgagcttcctgcggcgggcggtacagcttgaaagggtgatcgtcgtcgcc
ggcgagacgggatcaggcaagaccacactgatgaaagcgctgatgcaggaaattccgttc
gatcagcgcctgatcaccatcgaggacgtaccggagttgttcttgccggaccatccgaac
cacgtccacctgttttatccgagcgaagcgaaggaagaagaaaacgcaccagtgacggcc
gccacgctactgcggagctgcctgcgcatgaaaccgacgcgcatcctgcttgccgagctg
cgcggcggcgagacttacgatttcatcaacgtggccgcgtccggccatggcggcagcatc
accagttgccatgccggttcgtgcgaactgactttcgagcggctggcattgatggtgttg
cagaaccgccagggccgccagttgccatacgagatcatccgccggctgctctatctggtg
gtggatgtcgtcgtgcacgtccacaatggcgtgcacgacggcactggccgccatatatct
gaagtttggtacgacccgaatacaaaacgggcactgtcactgcaacacagtgagaagacg
caatga

DBGET integrated database retrieval system