KEGG   Bacillus subtilis subsp. subtilis 168: BSU23000
Entry
BSU23000          CDS       T00010                                 

Symbol
ypbE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysM DUF1616 Neur_chan_memb PBP1_TM Sigma_reg_N m04gp34like Pox_EPC_I2-L1 Zip Roughex Orf78 SAPS V_ATPase_I DUF6480 SID-1_RNA_chan Peptidase_S49_N CrgA
Other DBs
NCBI-GeneID: 938971
NCBI-ProteinID: NP_390181
Pasteur: BG11431
BSORF: BG11431
UniProt: P50731 A0A6M4JIR1
Position
complement(2405620..2406342)
AA seq 240 aa
MTNMSRVERRKAQNLYEDQNAALADDYVDDGESLPTRQSVKNQREQKKKQGKTKTPLFTV
LAVIFVFVPVIVLVTLFYLKSHPDNHDDYEDVFIDSSQSKYEVVPKSEDKNDTADTKETA
LQKESKKEPEDSKPKEQTAADKKQTAVAEKEDSPNKEEATAAAASSSQSTVQQQEQPAEP
VQNVPNRVVKHTVQKKETLYRISMKYYKSRTGEEKIRAYNHLNGNDVYTGQVLDIPLMDE
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacgaacatgtcgagagtagagagaagaaaagcccagaatctttatgaagatcaaaac
gccgcattggcggacgattatgtcgatgatggagaaagccttccgacaagacaatctgta
aaaaatcaaagagaacagaaaaaaaagcaaggcaaaacaaaaacgccattattcacagta
ctcgcagtaatatttgtatttgtgccggttatcgttttagtcaccttattttatctaaag
agccacccggataatcatgacgattatgaagatgtttttattgacagcagccaaagcaaa
tatgaggttgtcccgaaatcagaggataaaaacgataccgcagacactaaagaaaccgca
ctgcagaaggagtcaaaaaaagagccagaagattccaagccaaaagagcaaacagctgct
gataagaaacagactgctgtagcggaaaaagaagactcgccaaataaggaggaagcaacc
gccgcggctgcttcctcttcccaatcaacagtacaacagcaagaacagccagctgagcca
gttcaaaatgtgccgaatcgcgttgtcaagcacaccgtccaaaagaaagaaacgctatac
cgcatttccatgaagtattataaaagccggacaggagaagaaaaaattcgagcatataat
catctgaatggaaatgatgtttacaccggacaagttttggacatccctttaatggatgaa
tag

DBGET integrated database retrieval system