KEGG   Bacillus subtilis subsp. subtilis 168: BSU35170
Entry
BSU35170          CDS       T00010                                 

Gene name
uvrB
Definition
(RefSeq) UvrABC system protein B
  KO
K03702  excinuclease ABC subunit B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU35170 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU35170 (uvrB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU35170 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BSU35170 (uvrB)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR AAA_30 DEAD TrwB_AAD_bind AAA_7 AAA DUF87 AAA_25 AAA_22 AAA_5 AAA_6
Other DBs
NCBI-GeneID: 936663
NCBI-ProteinID: NP_391397
Pasteur: BG10502
BSORF: BG10502
UniProt: P37954
Structure
PDB: 
2D7D 2NMV 3V4R

Position
complement(3612945..3614930)
AA seq 661 aa
MKDRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPT
LVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEID
KLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQ
YARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDH
VAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREM
GFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQV
LVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDP
LIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIK
TLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGR
AARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKEIRDVIRATV
AAEDKAEYKTKAAPKLSKMTKKERQKVVEQMEHEMKEAAKALDFERAAELRDLLLELKAE
G
NT seq 1986 nt   +upstreamnt  +downstreamnt
gtgaaagatcgctttgagttagtctcgaaatatcagccccagggagatcagccgaaagcc
attgaaaagcttgtgaaaggaattcaggagggcaagaagcatcagactctgctgggtgca
acaggaactgggaaaacatttacggtgtccaatttgattaaagaagtcaataagccgact
ctcgtgattgcccataacaaaacccttgctggacagctttacagtgagttcaaggaattt
tttccgaacaatgctgtcgagtattttgtcagctactatgattattatcagccggaggcg
tatgtgcctcaaacggatacatttatagagaaagacgctagtattaatgatgaaattgat
aaactgagacactccgccacatcagctttgtttgagcgcagagatgtcattattattgcg
agtgtgtcttgtatatacggcctcggttcgcctgaggaataccgggaaatggtcgtgtca
ctgcggactgaaatggaaattgagcgcaacgagctgctcagaaaacttgtagacatccaa
tatgcccgcaacgatatcgactttcagcgcggtacatttcgtgtgcgcggggatgtagtg
gaaatctttccggcatcccgtgatgagcattgtgtcagagttgaatttttcggtgacgaa
atcgaacggattcgggaagtagatgcgctgacaggagaaattctcggcgaccgagatcat
gttgcgattttcccggcatcccacttcgtaacgcgggccgagaaaatggagaaggcgatt
caaaatatcgagaaggagcttgaggagcagctgaaggtcatgcatgaaaacggaaagctc
cttgaagcgcagcgtttagagcagcggacaagatatgatcttgaaatgatgcgtgaaatg
ggtttctgctccggcatcgagaactattcaagacatttgactctgcggcctccaggttca
acgccgtatacgcttcttgattatttcccagacgattttatgatcgtggtggatgagtcg
catgtgacaattcctcaggtgcgcggcatgtttaacggagaccaggcgcggaaacaggtg
ctcgtggatcacggcttccggcttccatcagcgcttgataaccgtccgcttcgttttgag
gaatttgaaaagcatatgcacaatatcgtgtatgtatcagcaacaccagggccgtacgag
attgaacatacagatgaaatggtcgaacagatcattcgtccgacggggcttcttgacccg
cttattgacgtccgtccaatcgaaggtcagattgacgacttgatcggcgaaattcaagca
agaatcgagcggaatgaacgggtgcttgtgacaactttgacgaagaagatgtcagaggat
ctgaccgattatttaaaggaaatcggcattaaagtaaactatctgcattctgagatcaag
acgcttgaacggattgaaattatccgcgacctgcgccttggcaagtacgatgtgcttgtc
ggcatcaacctgctgagggaaggtttggacattcccgaagtatcccttgttgcgattttg
gatgcggataaggaaggtttccttcgttcggagcggtcgctgatccagaccatcggacgg
gcagcgagaaatgcggaaggccgcgtcattatgtacgccgataaaataacgaagtctatg
gaaattgcgattaatgaaacaaaacgccgccgcgagcagcaggagcggtttaacgaagag
cacggcattacgccgaaaacgataaataaagaaattcgcgatgtcattcgtgccacagta
gcagctgaggataaagcggaatacaaaacaaaagccgcgccgaagctgtcgaaaatgacg
aagaaagaacgccagaaagtcgttgaacagatggagcatgaaatgaaggaagccgccaag
gcgcttgactttgagagagccgcggagcttcgcgatttacttttagagctaaaagcggaa
ggatga

DBGET integrated database retrieval system