KEGG   Bacillus subtilis subsp. subtilis 168: BSU39580
Entry
BSU39580          CDS       T00010                                 

Symbol
yxeE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: APG6_N Not3 DUF16 MbeD_MobD AAA_13 IFT57 PI3K_P85_iSH2 DUF1664 DUF3450 GAS PTRF_SDPR Tho2 SlyX FapA Nup88 Crescentin Fmp27_WPPW Nsp1_C DUF948 Lebercilin TolA_bind_tri ADIP Spc24 Baculo_PEP_C BLOC1_2 Exonuc_VII_L YlqD WDCP DUF6262 GldM_N CENP-F_leu_zip V_ATPase_I EspA_EspE HAUS-augmin3 RmuC DUF489 TMPIT DUF5595 CENP-H TMF_TATA_bd DASH_Dad4 CENP-Q Fib_alpha DLP_helical
Other DBs
NCBI-GeneID: 936477
NCBI-ProteinID: NP_391837
Pasteur: BG11881
BSORF: BG11881
UniProt: P54944 A0A6M4JQV4
Position
4065597..4065962
AA seq 121 aa
MNPYQYYSPQLPQQEPYYSHYEYNPYPQQDVYDPYQMDRQPALERRIAALERQNEQQSRE
LTRLTNEDRRQNREIARIAEQVNQLSQAVERHTRRLNRLNQRLRTVENRLNIPFTAGEGG
F
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaacccttatcaatattacagccctcagctgcctcagcaggaaccttactatagccac
tatgagtacaatccttatccgcagcaggatgtatacgatccataccaaatggacagacag
ccggcattggaaagaagaatcgcagcacttgaacggcaaaatgaacagcagtcaagagaa
ttaacccgtctgacaaacgaagaccgccgtcaaaatcgggaaattgcacggattgccgaa
caggtcaatcagttaagccaggctgttgaacgccatacacgccgcctaaatcggctcaat
cagcgcctccgtacagtagaaaaccggctgaatatcccatttactgcaggggaaggcggt
ttctga

DBGET integrated database retrieval system