KEGG   Caenorhabditis elegans (nematode): CELE_T23H2.5
Entry
CELE_T23H2.5      CDS       T00019                                 

Gene name
rab-10
Definition
(RefSeq) Ras-related protein Rab-10
  KO
K07903  Ras-related protein Rab-10
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CELE_T23H2.5 (rab-10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T23H2.5 (rab-10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T23H2.5 (rab-10)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_T23H2.5 (rab-10)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    CELE_T23H2.5 (rab-10)
 Protein recycling
  Rab GTPases and associated proteins
    CELE_T23H2.5 (rab-10)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T23H2.5 (rab-10)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T23H2.5 (rab-10)
  Exosomal proteins of colorectal cancer cells
   CELE_T23H2.5 (rab-10)
  Exosomal proteins of bladder cancer cells
   CELE_T23H2.5 (rab-10)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    CELE_T23H2.5 (rab-10)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin AAA_7 TniB AAA
Other DBs
NCBI-GeneID: 266836
NCBI-ProteinID: NP_491857
WormBase: WBGene00004273
Ensembl: WBGene00004273
UniProt: Q94148
Position
I:complement(join(6457365..6457451,6457822..6457900,6457978..6458290,6458346..6458472))
AA seq 201 aa
MARRPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMIL
GNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTDE
QSRDTVNPVQPQRQSSSGGCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atggctcgccgaccgtatgacatgctcttcaaattgctgctaataggcgactcaggagtt
ggaaaaacttgcattctgtacagattttcggatgatgcctttaacaccacattcatctca
actattggaatcgacttcaaaattaaaactatcgaattaaaaggaaaaaagattaaatta
caaatctgggacacagctggacaagaacgattccacacaatcacaacatcatattaccgc
ggagcaatgggaattatgctggtttacgatatcacaaatgcgaaaagttttgacaatatt
gcaaagtggttgcgcaatattgacgaacatgcatcggaagatgttgttaaaatgatattg
ggaaataaatgtgatatgagtgatagacgagttgtgagcagagaacgaggagagaagatc
gcacaagatcatggtattagcttccacgagacttcagctaaattgaatgttcacgtcgat
acagcgttttacgatttagcagaagcaattctggctaagatgcctgattccactgacgag
caatcccgcgatacggtgaatccagtgcaaccacagaggcagagtagcagtggaggatgc
tgctag

DBGET integrated database retrieval system