KEGG   Caenorhabditis elegans (nematode): CELE_W03C9.3Help
Entry
CELE_W03C9.3      CDS       T00019                                 

Gene name
rab-7
Definition
(RefSeq) RAB family
  KO
K07897  Ras-related protein Rab-7A
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04137  Mitophagy - animal
cel04140  Autophagy - animal
cel04144  Endocytosis
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CELE_W03C9.3 (rab-7)
   04145 Phagosome
    CELE_W03C9.3 (rab-7)
   04140 Autophagy - animal
    CELE_W03C9.3 (rab-7)
   04137 Mitophagy - animal
    CELE_W03C9.3 (rab-7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_W03C9.3 (rab-7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_W03C9.3 (rab-7)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_W03C9.3 (rab-7)
Membrane trafficking [BR:cel04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    CELE_W03C9.3 (rab-7)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_W03C9.3 (rab-7)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_W03C9.3 (rab-7)
  Exosomal proteins of colorectal cancer cells
   CELE_W03C9.3 (rab-7)
  Exosomal proteins of bladder cancer cells
   CELE_W03C9.3 (rab-7)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    CELE_W03C9.3 (rab-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase cobW GTP_EFTU AAA_16 AAA_22 Septin AAA_24 PduV-EutP SRPRB AAA_7 ATPase_2 DAP3 NTP_transf_9 AAA_5 TniB NACHT MCM
Motif
Other DBs
NCBI-GeneID: 174834
NCBI-ProteinID: NP_496549
WormBase: WBGene00004271
Ensembl: WBGene00004271
UniProt: Q23146
Position
II:complement(join(11965655..11965741,11966084..11966291,11966442..11966593,11966640..11966705,11966786..11966902))
Genome map
AA seq 209 aa AA seqDB search
MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTL
QIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFP
FVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARES
QETNDFPEFPDQIRLNPNQQNQQNSGCNC
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaccagaaagaaggcgctgctcaaagtgatcattctcggagattcgggcgtt
ggaaaaacatctttgatgaatcaatatgtaaatcggcgatttagtaatcaatataaggca
acgattggagccgacttcctcacacgcgacgtaaacattgacgacagaaccgtcactctt
cagatctgggatacagccggccaggaacgtttccaatcgctcggagtcgctttttatcgt
ggagccgattgctgtgtgctggcttttgacgtcacaaatgccgcctcgttcaaatcgctt
gactcgtggcgtgacgagtttctgattcaggctagcccccgcgatccagaccatttcccg
tttgtcctgctcggaaacaaggtggatttggagtcacagcgtgccgtttcgtcaaaacgt
gctcaatcttggtgccagacgaagggaaatattccgtattacgaggtttctgccaaggaa
gctctcaacgttgaagccgcatttttggcaattgctcgtgatgcgttggctagagaatct
caggaaaccaacgatttcccagagtttcccgaccaaatccgtctcaacccaaatcaacag
aaccagcagaattcgggatgcaattgttaa

DBGET integrated database retrieval system