KEGG   Canis familiaris (dog): 403956Help
Entry
403956            CDS       T01007                                 

Gene name
RAB4B
Definition
(RefSeq) ras-related protein Rab-4B
  KO
K07880  Ras-related protein Rab-4B
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    403956 (RAB4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403956 (RAB4B)
   04031 GTP-binding proteins [BR:cfa04031]
    403956 (RAB4B)
Membrane trafficking [BR:cfa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    403956 (RAB4B)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   403956 (RAB4B)
GTP-binding proteins [BR:cfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    403956 (RAB4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_7 AAA_16 SRPRB ATPase Septin UvrD-helicase AAA_22 ATPase_2
Motif
Other DBs
NCBI-GeneID: 403956
NCBI-ProteinID: NP_001003275
Ensembl: ENSCAFG00000005083
UniProt: P61017
Position
1
AA seq 213 aa AA seqDB search
MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ
IWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCG
NKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDP
ERMGSGIQYGDASLRQLRQPRSAQAVAPQPCGC
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacctacgacttcctcttcaaattcctggtgattggcagtgcaggaactggc
aaatcatgtctccttcatcagttcattgagaataagttcaaacaggactccaaccacaca
atcggcgtggagtttggatctcgggtagtcaacgtgggtgggaagactgtgaagctccag
atttgggacacagccggccaagagcggtttcggtcggtgacacggagttactaccgaggg
gcggctggagccctgctggtgtacgacatcaccagccgggagacatacaactcgttggct
gcctggctgacggacgcccgcacgctggctagccccaacatcgtggtcatcctctgtggc
aacaagaaagacctggaccctgagcgcgaggtcactttcctggaggcctcccgctttgcc
caggagaatgagctaatgttcctggagactagtgctctcacgggtgagaacgtggaagag
gctttcctgaagtgtgcccgcaccatcctgaacaagatcgactcaggtgagctggacccc
gagaggatgggctcaggcattcagtacggggatgcttccctccgccagctgcggcagcct
cggagtgcccaggccgtggccccccagccctgtggctgctga

DBGET integrated database retrieval system