KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395022
Entry
100395022         CDS       T03264                                 

Gene name
RAB1A
Definition
(RefSeq) RAB1A, member RAS oncogene family
  KO
K07874  Ras-related protein Rab-1A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04140  Autophagy - animal
cjc05014  Amyotrophic lateral sclerosis
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100395022 (RAB1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100395022 (RAB1A)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100395022 (RAB1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100395022 (RAB1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100395022 (RAB1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100395022 (RAB1A)
   04031 GTP-binding proteins [BR:cjc04031]
    100395022 (RAB1A)
Membrane trafficking [BR:cjc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    100395022 (RAB1A)
 Autophagy
  Other autophagy associated proteins
    100395022 (RAB1A)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100395022 (RAB1A)
  Exosomal proteins of other body fluids (saliva and urine)
   100395022 (RAB1A)
  Exosomal proteins of colorectal cancer cells
   100395022 (RAB1A)
GTP-binding proteins [BR:cjc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    100395022 (RAB1A)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA SRPRB AAA FeoB_N PduV-EutP AAA_16 AAA_7 AAA_22 AAA_29 ABC_tran Septin AAA_5 LANC_like TniB Dioxygenase_N
Other DBs
NCBI-GeneID: 100395022
NCBI-ProteinID: XP_002757737
Ensembl: ENSCJAG00000006749
UniProt: F7GSP9
Position
14
AA seq 205 aa
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL
LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA
TAGGAEKSNVKIQSTPVKQSGGGCC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct
ggggttggaaagtcttgccttcttcttaggtttgcagatgatacatatacagaaagctac
atcagcacaattggtgtggatttcaaaataagaaccatagagttagatgggaaaacaatc
aagcttcaaatatgggacacagcaggccaagaaagatttcgaacaatcacctccagttat
tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat
aatgttaaacagtggctgcaggaaatagatcgttatgccagtgaaaatgtcaacaaattg
ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcaaag
gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaatgcaacgaat
gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca
acagctggtggtgccgagaagtccaatgttaaaattcagagcactccagtcaagcagtca
ggcggaggttgctgctaa

DBGET integrated database retrieval system