KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2108
Entry
Dmel_CG2108       CDS       T00030                                 

Gene name
Rab23
Definition
(RefSeq) Rab23
  KO
K06234  Ras-related protein Rab-23
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG2108 (Rab23)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dme04031]
    Dmel_CG2108 (Rab23)
Membrane trafficking [BR:dme04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    Dmel_CG2108 (Rab23)
GTP-binding proteins [BR:dme04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab23
    Dmel_CG2108 (Rab23)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 FeoB_N GTP_EFTU AAA_7 Gtr1_RagA PduV-EutP DLIC MMR_HSR1_Xtn ATP_bind_1 Het-C Ribosomal_S5_C AAA_16
Other DBs
NCBI-GeneID: 40701
NCBI-ProteinID: NP_649574
FlyBase: FBgn0037364
UniProt: Q9VNG6
Position
3R
AA seq 268 aa
MRLIQTATGGAAASVLQTHSQAQYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKG
IFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCITKAYYRGAQASVLVFSTT
DRASFDAIKDWKRKVENECNEIPTVIVQNKIDLIEQAVVTADEVETLAKLLNCRLIRTSV
KEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSSTPTISAFSPTFTKSSSGT
IVLRPAKKGHGSSVARKRKIVLKKCGIL
NT seq 807 nt   +upstreamnt  +downstreamnt
atgcgtctaatccaaacggcaaccggcggtgctgctgcgtccgttctgcagacccactcc
caggcgcagtacaactacaccagcatgcgtgaagatgatatcgagctggccattaaagtg
gtcattgttggaaatggcggcgttggcaagtcatcaatgatccagcgctattgcaaaggc
attttcacgaaggactacaagaaaacgattggagtggacttcctagagcgacagatcgag
atcgacggcgaggatgtgcgcatcatgctgtgggacaccgccggccaggaggagttcgac
tgcatcacaaaggcgtactaccgcggcgcccaggcttccgtcctggtcttttcgacgacg
gatcgagcatccttcgacgcgatcaaggattggaagcgcaaggtggagaacgagtgcaac
gagatacccacagtgattgtgcagaacaagatcgatcttatcgaacaggcggtggttacg
gccgacgaggtggagacgctggccaagctcctcaactgccggctcatccgcacctccgtc
aaggaggacattaacgtggcgtccgtgtttcgctacctggccaccaagtgccatcagcta
atgacccagagctacgaccaggtggccggaaaccagcaaaactccagccatccgccttac
agcagcacgcccacgatcagcgccttcagcccgaccttcacaaagtccagcagcggcacc
atcgtcctccgtccggcgaagaagggccatggctccagcgtggcccgaaagcgaaagata
gtgctcaagaaatgcggaatattgtga

DBGET integrated database retrieval system