KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0966
Entry
Gdia_0966         CDS       T00798                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Gdia_0966
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gdj02044]
    Gdia_0966
Enzymes [BR:gdj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Gdia_0966
Secretion system [BR:gdj02044]
 Type IV secretion system
  Trb secretion system protein
   Gdia_0966
SSDB
Motif
Pfam: T2SSE Zeta_toxin TrwB_AAD_bind AAA_16 FtsK_SpoIIIE AAA_7 AAA_19 DEAD AAA_28 nSTAND3 MMR_HSR1 ABC_ATPase DUF815 ATPase CbiA Septin AAA_29 AAA_22 MobB GTP_EFTU AAA_30 Dynamin_N CLP1_P P-loop_TraG ResIII
Other DBs
NCBI-ProteinID: ACI50750
Position
complement(1090685..1091689)
AA seq 334 aa
MAVTPIENGARQRGMSMLRTAMGPAIAGHLADPAVVEVMLNPDGRLWTDRLSEGLGDTGD
RIAPADAERIVRLVAHHVGAEVHEAAPRVSAELPTGERFEGLLPPVVTAPSFAIRKPAVA
VFTLDDYVAAGIMTEGQAVFLRRAVVERKNILVAGGTSTGKTTLVNALLAEVAKTDDRVV
LIEDTRELQCTAPNLIALRTREGVITLSDLVRSGLRLRPDRIPIGEVRGAEALDLVKAWG
TGHPGGIGTLHAGSVLAALYRLEQLIQEAVVTVPRAMIAETIDVIAVLSGRGNSRRLSEL
AEIEGLDPTTGTYRIRPVSLSSPETSFAANGESS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcggttacaccgattgaaaatggtgcccgacagcgcggcatgtccatgctgcgcacg
gcgatgggaccggcgattgcggggcatttggcggacccagcagtggtcgaggtgatgctc
aatcccgatgggcggttgtggaccgaccgcttgtccgaggggctgggcgatacgggcgac
aggattgcacctgccgatgccgagcgcatcgtgcgtctggtggcccatcatgttggggcc
gaggtgcatgaagcggcaccgcgcgtatcggccgaactaccaaccggcgaacggttcgag
gggttactgccgcccgtggtgacggcccccagtttcgcgatccgcaagcccgccgtggcc
gtgttcacactcgacgattatgtcgccgccggaatcatgacggaggggcaggcggtgttt
ctgcgccgcgctgtcgtggaacggaaaaacattctggtcgcgggcgggaccagcacgggc
aagaccacgttggtcaatgccctgttggccgaagtcgcgaaaaccgatgaccgtgtcgtg
ctgatcgaggatacgcgcgaactgcaatgcacagcacccaatctcatagcgctgcggacc
cgcgaaggtgtcatcacgctgtcggacctcgtccgctctggtctccgcctgcgccccgac
cgtatccccatcggtgaggtacgtggggctgaagcccttgatctggtcaaggcatggggc
accgggcatcccggcggcatcggcacgctgcatgccggatcggtgctcgccgccctgtat
cggctggaacagttgatccaggaggcggtggtcacggtgccgcgcgccatgatcgctgaa
acgatcgacgtcatcgcggtcctgtccgggcgcggcaattcccgccgcctgtccgaactg
gctgaaatcgagggcctcgatcccacgaccggaacctatcgcatccgtccggtcagcctc
tcgtctcccgaaacatcctttgctgccaatggagaatcatcatga

DBGET integrated database retrieval system