KEGG   Halothiobacillus neapolitanus: Hneap_1622
Entry
Hneap_1622        CDS       T01104                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hna00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hneap_1622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hna02044]
    Hneap_1622
Enzymes [BR:hna01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Hneap_1622
Secretion system [BR:hna02044]
 Type IV secretion system
  Trb secretion system protein
   Hneap_1622
SSDB
Motif
Pfam: T2SSE Sigma54_activ_2 AAA_16 AAA_22 AAA_7 FtsK_SpoIIIE nSTAND3 ResIII ABC_tran P-loop_TraG Zeta_toxin TrwB_AAD_bind Sigma54_activat DEAD AAA_29 AAA_19 AAA_23 ABC_ATPase DUF87 IstB_IS21 AAA_18 Septin NACHT Pox_A32 Mg_chelatase UvrD-helicase GTP_EFTU TsaE TIP49 cobW AAA_28 RsgA_GTPase SRP54 SMC_N Dynamin_N PduV-EutP ATPase AAA_33 Bac_DnaA SWI2_SNF2 RNA_helicase PhoH AAA G-alpha IIGP AAA_5 ATP_bind_1 SLFN-g3_helicase MMR_HSR1 NB-ARC AAA_2
Other DBs
NCBI-ProteinID: ACX96450
UniProt: D0L177
Position
complement(1760053..1761093)
AA seq 346 aa
MLDEVTQRRLLEKLEREGGEVFISALRNPDVIEVMRNSDGRLWADFSGVGMKCLGEMAAS
RAESILSTCASMLGTALTRESPILEGEFPLDGSRLQGLVPPLSSTAVFAIRKKALKVFTL
ADYIERGILAEHSAEPHDFLSPIVSSMQSHAADWLNLALSTRLESAIREKMNILVVGGTG
SGKTTLANALLHSLSEQCPHDRIVAIEDTMELQVRVENAVLLRASEQVPMSRLLRATMRL
RPDRIIVGEVRGGEAYTLLKSWNSGHPGGLATIHANSAEEGLDKLSQYIFEAPDARNFSH
DMVGRMIASTVNVVVFIERTSMAPGRQVKQVVRVRGFKDGRFVFEG
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcttgatgaagtcacccaacgccgattactggaaaaactcgaacgcgaaggcggcgag
gtatttatctcggcactcagaaaccccgatgtcattgaagtcatgcgcaattctgatggc
cgcctttgggcggatttttcaggcgtgggcatgaagtgtttgggggaaatggccgcctca
cgcgccgaatcgattttatccacctgcgcctcgatgctcggtaccgccttgactcgcgaa
tcccccattctggaaggtgaatttccgctggacggctcacggcttcaggggttagttccg
cccttgtcttcaaccgccgtattcgcaatccgcaaaaaagcactcaaggtgtttaccctg
gccgactacatcgaacgcggaatacttgcggaacactcagcagaaccccatgattttctt
tccccaatcgtctcttctatgcaaagccacgccgcagattggttgaatctggcgctatca
acacgcctggaatctgcaattagagaaaagatgaatatcttggttgtcggcggtaccgga
tcaggcaaaaccacgctggccaacgcgttgctgcattcgttatcagagcaatgtcctcat
gaccgaattgttgcgattgaagacacgatggagttacaggtgcgcgtggaaaacgccgtg
ctgctccgtgcatccgaacaagtgcctatgtcgcgtttgcttcgcgcgacgatgcgcttg
cgacccgaccgaatcattgtgggcgaagtgcgtggcggtgaagcctataccctgctcaaa
tcttggaatagcggtcatcccggcggactggctaccattcacgccaatagtgcggaggaa
ggtctggataaactcagccagtacatcttcgaggcgccagatgcgcggaatttctcgcat
gacatggtgggcagaatgatcgccagcacggttaatgtggtggttttcatcgagcgaact
tcaatggcaccagggcggcaggtgaagcaggtcgtgcgcgtgcgcggcttcaaggatggg
cggtttgtatttgaggggtga

DBGET integrated database retrieval system