KEGG   Helicobacter pylori P12: HPP12_1326
Entry
HPP12_1326        CDS       T00786                                 
Symbol
virB4-2
Name
(GenBank) VirB4 type IV secretion ATPase
  KO
K12053  ComB4 competence protein
Organism
hpp  Helicobacter pylori P12
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpp02044]
    HPP12_1326 (virB4-2)
Secretion system [BR:hpp02044]
 Type IV secretion system
  DNA uptake competence system protein
   HPP12_1326 (virB4-2)
SSDB
Motif
Pfam: CagE_TrbE_VirB TrwB_AAD_bind FtsK_SpoIIIE DUF87 AAA_22 TraG-D_C PduV-EutP AAA_29 SAM_DrpA MMR_HSR1 AAA_7 RsgA_GTPase AAA_16 ABC_tran Sporozoite_P67 RNA_helicase
Other DBs
NCBI-ProteinID: ACJ08477
UniProt: B6JNJ9
Position
1397130..1399706
AA seq 858 aa
MLESALKYCKEKAIDLLAGFVPKTYSMAQECNILGLYDDTFIITKQENLVGIISLQGLSY
SNLMQKDLEGYFDTRQNVLNTISKDIQLRIVAKRRKEFINQSPNIDNIYAKAIITQFESK
EIYKTEYFLVFETITSNVKSFFEKKKLEMTTSINEELEESSKEDKQENENSSNETHSNTS
SKKDKKNKFKKKITFSTTSKRALLIQTIERVKNALKEFKPTLLNSKEVLNFYAEYINGKY
IAFNPKLKRLSDSYIASNVHFKKDYFVIEFQNQNTFCACVGIKAYESEEISSLPISTLLH
TQIELDLIFHIRSLGQFESLNFLKTKKKLTLSKIVKADIDNYIELVQANRLSMQECALNL
VIRAKSKAKLDKSLKEILSLLNNAGLGSVTETIGLKPSYFSFFPNNANINPRMRHQTSQV
IASLILFEKNNTGFRANSWGDMPLSVFKNLDHSPYLFNFHNQEVKHKGVLAHNVARVVGH
TMIIGATGAGKTTLISYLMMSALKYSNIDILALDRLNGLYSFTKYFDGIYNQGENFHINP
FSLEDSATNRAFLLHFYAQMAKVDSYDDHKDKVEDRTALLNAIDTMYRNYNDEVKQAKFS
NQELPLPFDLKEFVNSIVKTNTDILDSSFEDYLKSSLFSSRMDSLDFKTRISTINTDSIL
HNDDDAGLLAYYVFHKMIDRALKINRGFLCFIDEFKSYAQNEMMNKKINEIITQARKANG
VIVLALQDINQLSEVRNAQSFIKNMGQLILYPQRNIDTKDLNDKFGIRLSDTEKHFLENT
AVNEYKVLLKNMNDGSSNIIDVSLSSLGNYLQIFSSNSSMVEHIDNLIKHYPKTWREVFV
SNKHENFDDKKHLEKVLK
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgttagaaagcgcccttaaatattgcaaggaaaaagccatagaccttttagcagggttt
gtgccaaaaacctattctatggcacaggagtgcaatattttaggcttgtatgatgatact
ttcattattaccaaacaagaaaatctagtaggcattatatccttacaaggactaagctat
tctaatttaatgcaaaaagacttagagggctattttgatactagacaaaatgttctcaac
accattagtaaagacattcaattaagaattgtggctaaaaggcgtaaggaatttatcaat
caaagtccaaatattgacaatatttatgccaaagctattatcacacaatttgaaagcaag
gaaatctataaaacagagtattttttagtgtttgaaactatcacttctaatgtcaagtct
ttctttgaaaaaaagaaattggaaatgactacttcaattaatgaagagttagaagaaagc
tctaaagaagataaacaagagaatgaaaatagctccaatgaaactcattcaaacacaagc
tctaaaaaagacaagaaaaacaagttcaaaaaaaagataacctttagcaccacaagtaaa
agagccttactcattcaaaccatagaaagagtaaaaaacgctcttaaagaatttaaaccc
actttactaaattctaaagaagtattaaatttctacgcagaatacatcaatggcaaatac
atcgcctttaatcctaaattaaagcgattaagcgatagctatattgcatctaatgtgcat
tttaagaaagattactttgtcattgaatttcaaaatcaaaacaccttttgtgcgtgtgtg
gggattaaggcttatgagagcgaagaaatttcttcgctccctatatctactcttttacac
acccaaattgaactagatttaatctttcatatccgctctttaggacaatttgaaagcctg
aattttttaaaaactaagaaaaagctcacgctttctaaaatagtaaaagctgatattgat
aattatatagaattagtgcaagccaatcgtttgagcatgcaagagtgtgctttaaactta
gttataagggctaaaagtaaagctaaattagacaagtctttaaaagagattttatccttg
cttaataatgctggactaggcagtgttacagaaactatagggctaaaaccatcttatttt
tcattcttcccaaataacgccaatatcaaccctagaatgagacatcaaacttcccaagtc
atagcatctttgattttgtttgagaaaaataatacaggttttagagcaaattcttggggg
gatatgcccttatctgtgtttaagaacctagaccatagcccttatttgtttaattttcat
aatcaagaagtcaaacataagggcgtgttagcccacaatgtcgcacgagtagtgggacat
accatgattataggagcaacaggtgctggtaaaaccacactcattagctatttgatgatg
agtgccttaaaatattctaacattgatattttagctcttgatagactaaatggtttgtat
tcctttaccaagtattttgatgggatttataatcaaggcgaaaactttcatattaaccct
ttttcattagaagatagcgcaactaatagagcctttttattgcatttttatgcccaaatg
gcaaaagtggatagttatgatgaccataaggataaagtagaagatagaacagccctttta
aatgctattgatacgatgtatagaaattataacgatgaagtcaaacaagccaaatttagc
aaccaagaattaccccttccttttgatctaaaagagtttgtcaattccattgttaaaacc
aatacagacattttagatagtagttttgaagactatttaaaatcttccttattttctagc
cgaatggatagtctagattttaaaactcgtattagcaccataaataccgatagcatttta
cataatgatgatgacgctgggcttttagcctactatgtctttcataagatgattgacaga
gccttaaaaatcaatcgtgggtttttatgctttattgatgagtttaagtcttacgctcaa
aatgaaatgatgaataaaaaaatcaatgaaatcattactcaagctagaaaggctaatggg
gtgattgttctagccttacaagacattaaccaactaagcgaagtgagaaacgctcaaagc
tttataaaaaatatggggcaattgattttgtatccccaaagaaatattgataccaaagat
ttaaacgataaatttggcattagactaagcgatacagaaaaacattttttagaaaacacc
gccgttaatgaatacaaagtcttactcaaaaacatgaatgatggctcatctaacattata
gatgtgagcctaagttctttgggtaattacctacaaatctttagctctaattctagcatg
gtagaacacattgataatctcattaagcattaccctaaaacttggcgagaagtctttgtg
agtaacaaacacgaaaattttgatgacaaaaaacacttagaaaaggtgcttaaatga

DBGET integrated database retrieval system