KEGG   Homo sapiens (human): 4893Help
Entry
4893              CDS       T01001                                 

Gene name
NRAS, ALPS4, CMNS, N-ras, NCMS, NRAS1, NS6
Definition
(RefSeq) NRAS proto-oncogene, GTPase
  KO
K07828  GTPase NRas
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05034  Alcoholism
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
Network
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00004  Duplication-activated FLT3 to RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00006  Amplified EGFR to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00008  RET-PTC fusion kinase to RAS-ERK signaling pathway
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00018  Amplified PDGFR to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00031  Duplication-activated FLT3 to RAS-PI3K signaling pathway
N00032  Mutation-activated KRAS/NRAS to PI3K signaling pathway
N00041  EGFR-overexpression to RAS-ERK signaling pathway
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to EGF-EGFR-RAS-RASSF1 signaling pathway
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00152  CXCR-GNB/G-ERK signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00160  KSHV K1 to RAS-ERK signaling pathway
N00208  KSHV K1 to host-cell-protein activation
N00215  KITLG-KIT-RAS-ERK signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00233  IGF2-IGF1R-RAS-ERK signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00248  MET-overexpression to RAS-ERK signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00259  Amplified MET to RAS-ERK signaling pathway
N00267  HBV HBx to host-cell-protein activation
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
Disease
H00003  Acute myeloid leukemia (AML)
H00010  Multiple myeloma
H00016  Oral cancer
H00018  Gastric cancer
H00032  Thyroid cancer
H00033  Adrenal carcinoma
H00038  Melanoma
H00108  Autoimmune lymphoproliferative syndromes (ALPS)
H00523  Noonan syndrome and related disorders
H01481  Myelodysplastic syndrome (MDS)
H01666  Angiosarcoma
H01738  Noonan syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4893 (NRAS)
   04015 Rap1 signaling pathway
    4893 (NRAS)
   04010 MAPK signaling pathway
    4893 (NRAS)
   04012 ErbB signaling pathway
    4893 (NRAS)
   04370 VEGF signaling pathway
    4893 (NRAS)
   04371 Apelin signaling pathway
    4893 (NRAS)
   04068 FoxO signaling pathway
    4893 (NRAS)
   04072 Phospholipase D signaling pathway
    4893 (NRAS)
   04071 Sphingolipid signaling pathway
    4893 (NRAS)
   04151 PI3K-Akt signaling pathway
    4893 (NRAS)
   04150 mTOR signaling pathway
    4893 (NRAS)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    4893 (NRAS)
   04137 Mitophagy - animal
    4893 (NRAS)
  Cell growth and death
   04210 Apoptosis
    4893 (NRAS)
   04218 Cellular senescence
    4893 (NRAS)
  Cellular community - eukaryotes
   04540 Gap junction
    4893 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    4893 (NRAS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    4893 (NRAS)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    4893 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    4893 (NRAS)
   04660 T cell receptor signaling pathway
    4893 (NRAS)
   04662 B cell receptor signaling pathway
    4893 (NRAS)
   04664 Fc epsilon RI signaling pathway
    4893 (NRAS)
   04062 Chemokine signaling pathway
    4893 (NRAS)
  Endocrine system
   04910 Insulin signaling pathway
    4893 (NRAS)
   04912 GnRH signaling pathway
    4893 (NRAS)
   04915 Estrogen signaling pathway
    4893 (NRAS)
   04917 Prolactin signaling pathway
    4893 (NRAS)
   04921 Oxytocin signaling pathway
    4893 (NRAS)
   04926 Relaxin signaling pathway
    4893 (NRAS)
   04919 Thyroid hormone signaling pathway
    4893 (NRAS)
   04916 Melanogenesis
    4893 (NRAS)
  Nervous system
   04725 Cholinergic synapse
    4893 (NRAS)
   04726 Serotonergic synapse
    4893 (NRAS)
   04720 Long-term potentiation
    4893 (NRAS)
   04730 Long-term depression
    4893 (NRAS)
   04722 Neurotrophin signaling pathway
    4893 (NRAS)
  Development
   04360 Axon guidance
    4893 (NRAS)
  Aging
   04211 Longevity regulating pathway - mammal
    4893 (NRAS)
   04213 Longevity regulating pathway - multiple species
    4893 (NRAS)
  Environmental adaptation
   04714 Thermogenesis
    4893 (NRAS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4893 (NRAS)
   05230 Central carbon metabolism in cancer
    4893 (NRAS)
   05231 Choline metabolism in cancer
    4893 (NRAS)
   05206 MicroRNAs in cancer
    4893 (NRAS)
   05205 Proteoglycans in cancer
    4893 (NRAS)
   05203 Viral carcinogenesis
    4893 (NRAS)
   05210 Colorectal cancer
    4893 (NRAS)
   05225 Hepatocellular carcinoma
    4893 (NRAS)
   05226 Gastric cancer
    4893 (NRAS)
   05214 Glioma
    4893 (NRAS)
   05216 Thyroid cancer
    4893 (NRAS)
   05221 Acute myeloid leukemia
    4893 (NRAS)
   05220 Chronic myeloid leukemia
    4893 (NRAS)
   05218 Melanoma
    4893 (NRAS)
   05211 Renal cell carcinoma
    4893 (NRAS)
   05219 Bladder cancer
    4893 (NRAS)
   05215 Prostate cancer
    4893 (NRAS)
   05213 Endometrial cancer
    4893 (NRAS)
   05224 Breast cancer
    4893 (NRAS)
   05223 Non-small cell lung cancer
    4893 (NRAS)
  Substance dependence
   05034 Alcoholism
    4893 (NRAS)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4893 (NRAS)
  Infectious diseases
   05166 HTLV-I infection
    4893 (NRAS)
   05161 Hepatitis B
    4893 (NRAS)
   05160 Hepatitis C
    4893 (NRAS)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    4893 (NRAS)
   05165 Human papillomavirus infection
    4893 (NRAS)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    4893 (NRAS)
   01522 Endocrine resistance
    4893 (NRAS)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    4893 (NRAS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4893 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   4893 (NRAS)
  Exosomal proteins of breast cancer cells
   4893 (NRAS)
  Exosomal proteins of colorectal cancer cells
   4893 (NRAS)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    4893 (NRAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA AAA_25
Motif
Other DBs
NCBI-GeneID: 4893
NCBI-ProteinID: NP_002515
OMIM: 164790
HGNC: 7989
Ensembl: ENSG00000213281
Vega: OTTHUMG00000012059
Pharos: P01111(Tchem)
UniProt: P01111 Q5U091
Structure
PDB: 

Position
1p13.2
AA seq 189 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaagtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system