KEGG   Homo sapiens (human): 54107
Entry
54107             CDS       T01001                                 

Symbol
POLE3, CHARAC17, CHRAC17, CHRAC2, YBL1, p17
Name
(RefSeq) DNA polymerase epsilon 3, accessory subunit
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    54107 (POLE3)
   03410 Base excision repair
    54107 (POLE3)
   03420 Nucleotide excision repair
    54107 (POLE3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    54107 (POLE3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    54107 (POLE3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    54107 (POLE3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     54107 (POLE3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    54107 (POLE3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    54107 (POLE3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      54107 (POLE3)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C BUD22 DUF5427 SpoU_methylase TAF DUF4746 Myc_N Pox_Ag35 DDHD Autophagy_act_C CDC45 NOA36 SID-1_RNA_chan Serinc V_ATPase_I
Other DBs
NCBI-GeneID: 54107
NCBI-ProteinID: NP_001265184
OMIM: 607267
HGNC: 13546
Ensembl: ENSG00000148229
Vega: OTTHUMG00000020523
Pharos: Q9NRF9(Tbio)
UniProt: Q9NRF9 A0A024R829
Position
9q32
AA seq 147 aa
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD
KSRDEDNDEDEERLEEEEQNEEEEVDN
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcggagaggcccgaggacctaaacctgcccaatgccgtgatcaccaggatcatcaag
gaggcgctcccggacggtgtcaacatctccaaggaggcccggagcgccatctcccgcgcc
gccagcgtcttcgtgctgtacgccacatcctgtgctaacaactttgcaatgaaaggaaag
cggaagacgctgaatgccagtgatgtgctctcagccatggaagagatggagttccagcgg
ttcgttaccccattgaaagaagctctggaagcatataggcgggagcagaaaggcaagaag
gaggcctcagagcaaaagaagaaggacaaagacaaaaaaacagactcggaagagcaagac
aagagcagggatgaggacaatgatgaagacgaagaaaggctggaagaagaagaacagaat
gaagaggaagaagtagacaactga

DBGET integrated database retrieval system