KEGG   Homo sapiens (human): 8934
Entry
8934              CDS       T01001                                 

Gene name
RAB29, RAB7L, RAB7L1
Definition
(RefSeq) RAB29, member RAS oncogene family
  KO
K07916  Ras-related protein Rab-7L1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    8934 (RAB29)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    8934 (RAB29)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA ATP_bind_1 PduV-EutP AAA_16 TniB DLIC MMR_HSR1_Xtn AAA_7 Ribosomal_S21
Other DBs
NCBI-GeneID: 8934
NCBI-ProteinID: NP_001129134
OMIM: 603949
HGNC: 9789
Ensembl: ENSG00000117280
Vega: OTTHUMG00000035998
Pharos: O14966(Tbio)
UniProt: O14966 Q6FGU7 B2R7I9
Structure
PDB: 
6HH2

Position
1q32.1
AA seq 203 aa
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQ
LWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPC
LLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTED
IMSLSTQGDYINLQTKSSSWSCC
NT seq 612 nt   +upstreamnt  +downstreamnt
atgggcagccgcgaccacctgttcaaagtgctggtggtgggggacgccgcagtgggcaag
acgtcgctggtgcagcgatattcccaggacagcttcagcaaacactacaagtccacggtg
ggagtggattttgctctgaaggttctccagtggtctgactacgagatagtgcggcttcag
ctgtgggatattgcagggcaggagcgcttcacctctatgacacgattgtattatcgggat
gcctctgcctgtgttattatgtttgacgttaccaatgccactaccttcagcaacagccag
aggtggaaacaggacctagacagcaagctcacactacccaatggagagccggtgccctgc
ctgctcttggccaacaagtgtgatctgtccccttgggcagtgagccgggaccagattgac
cggttcagtaaagagaacggtttcacaggttggacagaaacatcagtcaaggagaacaaa
aatattaatgaggctatgagagtcctcattgaaaagatgatgagaaattccacagaagat
atcatgtctttgtccacccaaggggactacatcaatctacaaaccaagtcctccagctgg
tcctgctgctag

DBGET integrated database retrieval system