KEGG   Klebsiella pneumoniae 342: KPK_1775Help
Entry
KPK_1775          CDS       T00772                                 

Gene name
virB11
Definition
(GenBank) P-type DNA transfer ATPase VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPK_1775 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_1775 (virB11)
Enzymes [BR:kpe01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     KPK_1775 (virB11)
Secretion system [BR:kpe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   KPK_1775 (virB11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE AAA_7 ABC_tran AAA_22 Pox_A32 DUF87 FtsK_SpoIIIE NACHT TrwB_AAD_bind AAA_16 Septin RNA_helicase TsaE AAA_10 AAA_29 AAA_5 Sigma54_activat ATP_bind_1 Microtub_bd dNK AAA_24 AAA_23 Zeta_toxin AAA_30 DEAD
Motif
Other DBs
NCBI-ProteinID: ACI08682
UniProt: B5XPM9
Position
complement(1841703..1842722)
Genome map
AA seq 339 aa AA seqDB search
MSAENLSLDFMKNQLFGDYLPVEGLTEIAINRPGELHTKIKGAWQQRESPVTLRQCYAFA
KALASWHDDNIDDTSPILSATLESGERIQTIIPPACERNTVSITLRKPSFEQKTHQSWID
VGFYQRVAGQEKTESQDDALIQLYHSGNIPRFMEKAVEYGKTIFIVGETGSGKTTYMKTL
LHYIPWHLRLTTIEDNPEIRFYHHANYVHLFYPADAGDNAIVTPGRLIRANYRMNPDRIL
LAEIRGREAWDALKIVGSGHEGLITSMHAGSPEECIEGIIDRCYENPDCRNIPFDVLLRK
VLKSIDVIVSIDIHGDVRRMSDIYFKPVHLNSMKEAFKQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgaaaacctgtcactggattttatgaaaaatcagctgttcggtgattatctg
ccagtcgaagggctgaccgaaatcgcgattaaccgaccgggggaactgcacaccaaaata
aagggggcatggcagcagcgtgaatccccggtcacgctgcgtcagtgttacgcctttgcc
aaagcactggcgtcctggcatgacgataatattgacgatacgtcaccgatactgtcggcc
acgctcgaatccggcgagcgtattcagacgattattcccccggcctgtgagcgtaatacg
gtatccattacgttacgcaaaccctcgtttgagcagaaaacacatcagtcatggattgat
gtgggattttatcagcgcgtggccggtcaggagaaaacggaaagtcaggatgatgcactg
attcagttatatcacagcgggaatattccccgctttatggaaaaagcggtggaatatggc
aaaacgatttttattgtgggtgaaaccggctccggtaaaaccacctatatgaaaacgcta
ctgcattatattccgtggcatctccggctaaccaccattgaggataatcctgaaatccgt
ttttatcaccacgccaattatgttcatcttttttacccggcggatgccggggataacgct
attgtcacgcctggcaggctgattcgtgctaattatcggatgaaccctgaccggatatta
ctggcggaaattcgtgggcgtgaagcgtgggacgcgctgaaaattgtcggctcgggacat
gaaggactaatcacctccatgcacgcgggcagcccggaagaatgtattgaagggatcatt
gaccgctgctatgaaaaccccgactgccggaatattccttttgatgtgctgttacgcaag
gtacttaaaagcattgatgtcatcgtcagtattgacatacacggcgatgtgcgccggatg
agtgatatttactttaagccagttcatttaaacagcatgaaagaggcattcaaacaataa

DBGET integrated database retrieval system