KEGG   Leptotrichia buccalis: Lebu_0968
Entry
Lebu_0968         CDS       T00975                                 
Name
(GenBank) type II secretion system protein E
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
lba  Leptotrichia buccalis
Pathway
lba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lebu_0968
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lba02044]
    Lebu_0968
Enzymes [BR:lba01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Lebu_0968
Secretion system [BR:lba02044]
 Type IV secretion system
  Trb secretion system protein
   Lebu_0968
SSDB
Motif
Pfam: T2SSE AAA_19 nSTAND3 DEAD AAA_22 TsaE AAA_28 AAA_30 FtsK_SpoIIIE RsgA_GTPase AAA_7 AAA_16 AAA_18 ATP_bind_1 RNA_helicase GTP_EFTU GvpD_P-loop ResIII dNK SLFN-g3_helicase ATPase TrwB_AAD_bind Zeta_toxin CbiA NACHT DPPIV_rep
Other DBs
NCBI-ProteinID: ACV38870
UniProt: C7N9N9
Position
complement(1057556..1058563)
AA seq 335 aa
MTESEKYELQKQTQIDFVNERLSALKEYMEDDDITEIMLNPDGYVWVESYERGMYKTNTY
LNEMEGYKIIQVLASYNSKIISEKNPRLSGNLPNSDRFQGAAKGITKGIPIFTIRKRPKK
IFTLDDYLAMGSITEFQKNFLTEAILSKKNIVVSGGTGTGKTTFTNALVDYLKQVDRIRN
TVERIYIIEEVEEIICDKENVLRVFVTEDVSALELSKDALRHRPDRIIQGELRYGEEAEE
ILKNWNTGHSGGFTTVHSDGAEETLERLEELLMEVDRNPRQPLIGRSVDVIVNIIRITEN
GKTVRKVNKIIKVNGFNKKTKEYEIEEVGYEAEGL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgacagaaagtgaaaaatatgaactgcaaaagcaaacacagatagattttgtaaatgaa
aggttgtcagcactgaaagaatatatggaagatgacgatattactgaaataatgctaaat
cccgatggatatgtatgggtggaatcatatgaaaggggaatgtataagacaaatacatat
ctgaatgagatggaaggatataaaattattcaagtattggcttcatacaactcaaagata
atttctgaaaaaaatccaagactttctggaaatttgccaaattctgacagatttcaggga
gctgcaaaaggaattactaaagggattccaatatttacaataaggaaaagacctaaaaaa
atatttacgcttgatgactatttagcaatgggttcaattacagaatttcagaaaaatttt
cttacggaagccattttaagtaaaaagaatatagttgtatcgggtggaactggtacagga
aagacaacatttactaatgctcttgttgattatttaaagcaagttgacagaattaggaat
actgttgaaagaatatacattattgaagaagttgaagaaattatttgtgataaggaaaat
gtgttaagagtttttgtaactgaagatgtttctgcattggaattatcaaaagatgcactt
agacacagacctgatagaattattcaaggagaacttagatatggagaagaagctgaggag
atacttaaaaactggaatactggtcatagtggaggatttacaacagtccattcggatggt
gcagaagaaactttggaaagactggaagaactattaatggaagttgacaggaatccaaga
cagccacttatagggcgttccgtagatgtaattgtaaatatcataagaataactgaaaat
ggtaaaactgtaagaaaggtaaataagataatcaaagtgaatggttttaacaaaaagaca
aaagaatatgaaattgaggaggtaggatatgaagctgaaggtttataa

DBGET integrated database retrieval system