KEGG   Mus musculus (mouse): 19334
Entry
19334             CDS       T01002                                 

Symbol
Rab22a, 3732413A17Rik, AI662177, AW319644, AW550514, E130120E14Rik, Rab, Rab22
Name
(RefSeq) RAB22A, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19334 (Rab22a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19334 (Rab22a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19334 (Rab22a)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    19334 (Rab22a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    19334 (Rab22a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA AAA_16 AAA_7 AAA_24 NTPase_1 AAA_5
Other DBs
NCBI-GeneID: 19334
NCBI-ProteinID: NP_077756
MGI: 105072
Ensembl: ENSMUSG00000027519
Vega: OTTMUSG00000016371
UniProt: P35285 Q0PD34
Structure
PDB: 
1Z0J 1YVD

Position
2 H4; 2 97.26 cM
AA seq 194 aa
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWD
TAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKC
DLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANPASGGKGF
KLRRQPSEPKRSCC
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcgctgagggaacttaaagtgtgcctgctcggggatacgggtgtgggtaaatcgagc
atcgtgtggcggtttgtggaagacagttttgatccgaatatcaatccaaccataggggca
tcttttatgaccaagactgtccagtaccaaaatgagctacataaattcctaatctgggat
acagctggacaagaacgatttcgtgcattggcaccaatgtactatcgagggtcagcagca
gccatcatcgtttacgacatcacaaaagaagagacgttttcaactctgaagaactgggtg
agagagctccgccagcacggcccccccagcattgtcgttgccatcgcagggaacaagtgc
gatcttactgatgtcagagaagtcatggagagagatgctaaggactacgcagattccatt
catgccatctttgtagagaccagcgcaaaaaatgcaataaacataaatgaactctttata
gaaattagtcgaagaattccatccactgatgccaacccagcgtctggcggcaagggcttc
aaactccgaagacagccatcggagccaaagcgaagctgctgctga

DBGET integrated database retrieval system