KEGG   Mus musculus (house mouse): 19341
Entry
19341             CDS       T01002                                 
Symbol
Rab4a, AI848268, Rab4
Name
(RefSeq) RAB4A, member RAS oncogene family
  KO
K07879  Ras-related protein Rab-4A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19341 (Rab4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19341 (Rab4a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19341 (Rab4a)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    19341 (Rab4a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    19341 (Rab4a)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 PduV-EutP Gtr1_RagA AAA_7 SRPRB AAA_22 AAA_16 Septin ATPase DUF2075 NACHT ATPase_2
Other DBs
NCBI-GeneID: 19341
NCBI-ProteinID: NP_033029
MGI: 105069
Ensembl: ENSMUSG00000019478
UniProt: P56371 Q3ULK1
Position
8:124532583..124562030
AA seq 218 aa
MAQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGK
YVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIV
LILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIES
GELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgcagaccgccatgtccgagacttacgatttcttgtttaaattcttggtcatcgga
aatgcgggaactggcaaatcttgcttgcttcatcagttcattgaaaagaaattcaaagat
gactcaaatcataccataggagtggaatttggctcaaagataataaatgtcggtggtaaa
tatgtaaagttacagatatgggacacggccggccaggagcggttcaggtctgtgacgaga
agctactacagaggtgcagctggggcactccttgtctatgacatcaccagccgagaaacc
tacaatgcgcttactaattggttaacagatgccagaatgctggcgagccagaacatcgtc
cttatcctctgcgggaacaagaaggacttggatgccgaccgggaagtcaccttcctcgaa
gcctccaggttcgcacaagagaatgagctgatgttcctggaaaccagtgcactgactggc
gagaacgtcgaagaggctttcatgcagtgtgcaaggaaaatacttaacaaaattgaatca
ggtgaactggaccccgagaggatgggctctggcatccagtatggagacgctgccctgaga
cagctgcggtcacctcggcgtacacaggctccaagtgcacaggagtgtggctgctag

DBGET integrated database retrieval system