KEGG   Mus musculus (house mouse): 19342
Entry
19342             CDS       T01002                                 
Symbol
Rab4b, 1500031G17Rik
Name
(RefSeq) RAB4B, member RAS oncogene family
  KO
K07880  Ras-related protein Rab-4B
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19342 (Rab4b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19342 (Rab4b)
   04031 GTP-binding proteins [BR:mmu04031]
    19342 (Rab4b)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    19342 (Rab4b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   19342 (Rab4b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    19342 (Rab4b)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_7 AAA_16 SRPRB ATPase Septin UvrD-helicase AAA_22 ATPase_2 DUF2075
Other DBs
NCBI-GeneID: 19342
NCBI-ProteinID: NP_083667
MGI: 105071
Ensembl: ENSMUSG00000053291
UniProt: Q91ZR1 Q4V9W8
Position
7:complement(26867858..26878308)
AA seq 213 aa
MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ
IWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCG
NKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDP
ERMGSGIQYGDISLRQLRQPRSAQAVAPQPCGC
NT seq 642 nt   +upstreamnt  +downstreamnt
atggccgagacctacgacttcctcttcaaattcctggtgattggcagtgctggaactggc
aaatcatgtcttctccaccagtttattgagaataagttcaaacaggactccaaccacact
atcggcgtggagtttggatccagggtggtcaacgttggggggaagactgtgaaactacag
atttgggacactgctggccaggagcggtttcggtcggtgacgcggagttattaccgaggg
gcagctggagccctgctggtgtatgacatcaccagccgggagacatacaactcactcgct
gcttggctaactgatgcccggacactggccagccccaacatcgtggtcatcctctgtggc
aacaagaaggacctggatcccgagcgtgaggtcactttcctagaggcttctcgctttgct
caggagaatgagctgatgttcctggagaccagcgctctcacgggtgagaatgtggaagaa
gctttcctcaagtgcgcgcgcaccatcctcaacaagatcgactcaggtgaactagaccca
gagaggatgggttcaggcattcagtatggcgacatatccctccgccagctgcggcagcct
cgcagcgcccaagccgtggcccctcagccctgtggctgctga

DBGET integrated database retrieval system