KEGG   Mus musculus (mouse): 19349
Entry
19349             CDS       T01002                                 

Gene name
Rab7, Rab7a
Definition
(RefSeq) RAB7, member RAS oncogene family
  KO
K07897  Ras-related protein Rab-7A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04144  Endocytosis
mmu04145  Phagosome
mmu05132  Salmonella infection
mmu05146  Amoebiasis
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19349 (Rab7)
   04145 Phagosome
    19349 (Rab7)
   04140 Autophagy - animal
    19349 (Rab7)
   04137 Mitophagy - animal
    19349 (Rab7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19349 (Rab7)
   05152 Tuberculosis
    19349 (Rab7)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    19349 (Rab7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19349 (Rab7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19349 (Rab7)
   04031 GTP-binding proteins [BR:mmu04031]
    19349 (Rab7)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    19349 (Rab7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19349 (Rab7)
  Exosomal proteins of other body fluids (saliva and urine)
   19349 (Rab7)
  Exosomal proteins of colorectal cancer cells
   19349 (Rab7)
  Exosomal proteins of bladder cancer cells
   19349 (Rab7)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    19349 (Rab7)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU cobW ATP_bind_1 PduV-EutP Septin AAA_22 NTPase_1 AAA_7 SRPRB AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NB-ARC NACHT TniB
Other DBs
NCBI-GeneID: 19349
NCBI-ProteinID: NP_001280581
MGI: 105068
Ensembl: ENSMUSG00000079477
Vega: OTTMUSG00000024646
UniProt: P51150 Q4FJQ0
Structure
PDB: 
5Z2M

Position
6 D1; 6 39.13 cM
AA seq 207 aa
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggtcatcatcctgggggactctggtgttgga
aagacctctctcatgaaccagtatgtgaacaagaagttcagtaaccagtacaaagccaca
ataggagcggactttctgaccaaggaggtgatggtggacgacagacttgttaccatgcag
atctgggacacagccggtcaagaacggttccagtctcttggtgtggccttctacagaggt
gcagattgctgtgttctggtgtttgatgtgactgcccccaacactttcaaaaccctcgac
agctggagagacgagtttctcatccaggccagcccccgggatcccgagaacttccctttt
gttgtgttgggaaacaagattgacctggaaaacagacaagtggccacaaagagggcacag
gcttggtgctacagcaaaaacaacattccttacttcgagaccagtgccaaggaggccatc
aatgtggagcaggccttccagacaattgctcggaatgcccttaaacaggaaacagaagtg
gaactgtacaatgaattccctgaacccatcaaactggacaagaatgaccgggccaaggcc
tccgcagaaagctgcagttgttga

DBGET integrated database retrieval system