KEGG   Mus musculus (house mouse): 72433
Entry
72433             CDS       T01002                                 
Symbol
Rab38, 2310011F14Rik, AU043391, cht
Name
(RefSeq) RAB38, member RAS oncogene family
  KO
K07923  Ras-related protein Rab-38
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    72433 (Rab38)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    72433 (Rab38)
Membrane trafficking [BR:mmu04131]
 Others
  Rab GTPases of specific organelles
   Melanosome
    72433 (Rab38)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    72433 (Rab38)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA TniB MMR_HSR1 AAA_22 AAA_7 PduV-EutP RnlB_antitoxin TsaE
Other DBs
NCBI-GeneID: 72433
NCBI-ProteinID: NP_082514
MGI: 1919683
Ensembl: ENSMUSG00000030559
UniProt: Q8QZZ8 Q5FW76
Position
7:88079481..88140780
AA seq 211 aa
MQTPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVR
LQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPV
SVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILAN
ECDLLESIEPDIVKPHLTSPKVVSCSGCAKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcagacacctcacaaggagcacctgtacaagctgctggtgatcggcgacctgggtgtg
ggcaagaccagcattatcaagcgctatgtgcaccaaaacttctcctcgcactaccgggcc
accattggtgtggacttcgcgctgaaggtgctccactgggacccagagacggtggtgcgc
ttgcagctctgggacattgctggtcaagaaagatttggaaacatgacaagagtttattac
cgggaagctatgggggcatttattgtttttgatgtcaccagaccagccacatttgaagcc
gtggcaaagtggaaaaatgatttggactcaaagttaacgctccctaatggtaagccagtg
tcagtggttctgttggccaacaaatgtgaccaagggaaggatgtgcttatgaacaatgga
ctcaagatggaccagttctgcaaggagcatggcttcgtaggatggtttgaaacatcagcc
aaggaaaacataaacattgatgaagcctcaagatgcctggtcaagcacatacttgcaaat
gagtgtgacctcctagagtctatagaaccggacattgtgaagccccatctcacatcgccc
aaggttgtcagctgctctggctgtgccaaatcctag

DBGET integrated database retrieval system