KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_6430
Entry
OCAR_6430         CDS       T00783                                 
Symbol
trbB2
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_6430 (trbB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_6430 (trbB2)
Enzymes [BR:oca01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCAR_6430 (trbB2)
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_6430 (trbB2)
SSDB
Motif
Pfam: T2SSE Zeta_toxin AAA_7 DEAD AAA_16 MMR_HSR1 AAA_28 FtsK_SpoIIIE ABC_ATPase TrwB_AAD_bind GTP_EFTU ABC_tran AAA_19 CbiA PduV-EutP AAA_29 ATPase IstB_IS21 ResIII TsaE DUF2694 DUF815 Septin
Other DBs
NCBI-ProteinID: ACI93543
Position
complement(2370804..2371802)
AA seq 332 aa
MAGHHHSNEGLSRGARMLRTALGPAIARYLEDAGIVEVMLNPDGRLWVDRLREGLVATDD
VLTPADGERIVRLVAHHVGAEVHPGSPRVSAELPETGERFEGLLPPVVMAPTFAIRKPAV
AVFTLADYVAANIMTAAQADVLRLAVERRKNILVAGGTSTGKTTLTNALLAEVAKTSDRV
VLIEDTRELQCAAPNLVALRTKDGVASLSDLVKSSLRLRPDRIPVGEVRGSEALDLLKAW
GTGHPGGIGTIHANTAIGALRRLEQLVQEAVVTVPRALIAETIDIVAVLSGRGAERRLAE
IAHVDGLDPATGDYHTLNALLPSPAFPKGDLE
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgggtcatcaccacagcaatgaaggattgtcgcgcggcgcaaggatgctgcgcacc
gcgcttggtccggcgatcgcccgctaccttgaggacgcaggcattgtcgaagtgatgttg
aatccggacggccggctatgggtcgaccggctgcgcgaaggtcttgtcgccactgacgac
gtgctgaccccggccgatggagagcgcatcgtgcgcctggtcgcgcatcatgtcggcgcc
gaggtgcatcccggctcgcctcgcgtctcggctgagctgccggagaccggcgaacgcttc
gagggattgcttccgcccgtcgtcatggcgcccacctttgcgatccgcaaacccgcggtc
gccgtgttcacgctcgccgattacgtcgcagcgaacatcatgaccgcagcgcaggctgac
gtactcaggctcgcggtcgagcgtcgtaagaacatattggtcgcaggtggcacttcgacc
ggaaagaccacgctgaccaacgcgctgttggcagaggtggcaaagacctccgaccgcgtg
gtgctgatcgaagatacccgcgagctgcaatgcgccgcgccgaatcttgtcgcgctgcgg
accaaggacggcgtcgcctcgctctccgatctagtgaaatcatcgctgcgcctgcgtccc
gatcgtattccggtcggcgaggtgcggggcagcgaagcgctcgaccttctcaaagcctgg
gggaccggacatcccggcggcatcggcaccatccacgccaacacggcgatcggcgcgctg
cgtcggctggagcaactcgtgcaggaggccgtcgtcacggtgccgcgtgccctgatcgcc
gagaccatcgacatcgtcgccgttctttcaggccgcggcgccgaacggcgtcttgccgag
atcgctcatgttgacgggctcgatccggccaccggcgactatcacacgctcaacgcgctg
ctcccatccccggcatttccgaaaggagaccttgaatga

DBGET integrated database retrieval system