KEGG   Afipia carboxidovorans OM5 (Goettingen): OCA5_c16190
Entry
OCA5_c16190       CDS       T01617                                 
Symbol
trbB3
Name
(GenBank) conjugal transfer protein TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
ocg  Afipia carboxidovorans OM5 (Goettingen)
Pathway
ocg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ocg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCA5_c16190 (trbB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ocg02044]
    OCA5_c16190 (trbB3)
Enzymes [BR:ocg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCA5_c16190 (trbB3)
Secretion system [BR:ocg02044]
 Type IV secretion system
  Trb secretion system protein
   OCA5_c16190 (trbB3)
SSDB
Motif
Pfam: T2SSE Zeta_toxin AAA_7 DEAD AAA_16 MMR_HSR1 AAA_28 FtsK_SpoIIIE ABC_ATPase TrwB_AAD_bind GTP_EFTU ABC_tran AAA_19 CbiA PduV-EutP AAA_29 ATPase IstB_IS21 ResIII TsaE DUF2694 DUF815 Septin
Other DBs
NCBI-ProteinID: AEI06333
UniProt: B6JHP6
Position
1752705..1753703
AA seq 332 aa
MAGHHHSNEGLSRGARMLRTALGPAIARYLEDAGIVEVMLNPDGRLWVDRLREGLVATDD
VLTPADGERIVRLVAHHVGAEVHPGSPRVSAELPETGERFEGLLPPVVMAPTFAIRKPAV
AVFTLADYVAANIMTAAQADVLRLAVERRKNILVAGGTSTGKTTLTNALLAEVAKTSDRV
VLIEDTRELQCAAPNLVALRTKDGVASLSDLVKSSLRLRPDRIPVGEVRGSEALDLLKAW
GTGHPGGIGTIHANTAIGALRRLEQLVQEAVVTVPRALIAETIDIVAVLSGRGAERRLAE
IAHVDGLDPATGDYHTLNALLPSPAFPKGDLE
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgggtcatcaccacagcaatgaaggattgtcgcgcggcgcaaggatgctgcgcacc
gcgcttggtccggcgatcgcccgctaccttgaggacgcaggcattgtcgaagtgatgttg
aatccggacggccggctatgggtcgaccggctgcgcgaaggtcttgtcgccactgacgac
gtgctgaccccggccgatggagagcgcatcgtgcgcctggtcgcgcatcatgtcggcgcc
gaggtgcatcccggctcgcctcgcgtctcggctgagctgccggagaccggcgaacgcttc
gagggattgcttccgcccgtcgtcatggcgcccacctttgcgatccgcaaacccgcggtc
gccgtgttcacgctcgccgattacgtcgcagcgaacatcatgaccgcagcgcaggctgac
gtactcaggctcgcggtcgagcgtcgtaagaacatattggtcgcaggtggcacttcgacc
ggaaagaccacgctgaccaacgcgctgttggcagaggtggcaaagacctccgaccgcgtg
gtgctgatcgaagatacccgcgagctgcaatgcgccgcgccgaatcttgtcgcgctgcgg
accaaggacggcgtcgcctcgctctccgatctagtgaaatcatcgctgcgcctgcgtccc
gatcgtattccggtcggcgaggtgcggggcagcgaagcgctcgaccttctcaaagcctgg
gggaccggacatcccggcggcatcggcaccatccacgccaacacggcgatcggcgcgctg
cgtcggctggagcaactcgtgcaggaggccgtcgtcacggtgccgcgtgccctgatcgcc
gagaccatcgacatcgtcgccgttctttcaggccgcggcgccgaacggcgtcttgccgag
atcgctcatgttgacgggctcgatccggccaccggcgactatcacacgctcaacgcgctg
ctcccatccccggcatttccgaaaggagaccttgaatga

DBGET integrated database retrieval system