KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_30940
Entry
PA14_30940        CDS       T00401                                 
Symbol
trbB
Name
(GenBank) putative conjugal transfer protein
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA14_30940 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_30940 (trbB)
Enzymes [BR:pau01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PA14_30940 (trbB)
Secretion system [BR:pau02044]
 Type IV secretion system
  Trb secretion system protein
   PA14_30940 (trbB)
SSDB
Motif
Pfam: T2SSE nSTAND3 TrwB_AAD_bind FtsK_SpoIIIE AAA_16 Zeta_toxin ResIII ABC_tran DEAD AAA_25 AAA_7 MMR_HSR1 CbiA AAA_29 AAA_28 MobB IstB_IS21 APS_kinase GTP_EFTU ATPase SRPRB CLP1_P AAA_22 TsaE Dynamin_N KTI12 TIP49 AAA_23
Other DBs
NCBI-ProteinID: ABJ11784
UniProt: A0A0H2ZAS0
Position
complement(2686957..2688027)
AA seq 356 aa
MSAVSQLPPEPRSSAAASLDRRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLS
SGRAPMGVEMPEADGERIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPA
FALRKRAIGVIPLERYVVDGMMTAAQAGFLVRAVRERQNVLIAGATSSGKTTLANALLAE
IAATGDRVLVLEDTVELQCAARDHVPLRTRAGVVSMTELVRSSMRLRPDRVVVGEVRGAE
ALDLIKVWGTGHPGGIATIHAGSALGALLRMEQLILEVAVNPPRALIAEAVNVVIHIAGR
GRKRRIESIARVVGSDGVGYQLADALETPFPELPLFPEAAPAAATSPSPDQPGELP
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcgccgtttcgcagttgccacccgagccacgctcgtccgctgcggcctcgctcgac
cggcgcatccagatgctgcgcacggcgatggggccgctgatcgccactgcgctcgaagac
cccgacgtggtggaaatcatgctcaacccggatcgtaccctttgggtggatcggctttcg
agtgggcgcgcgccgatgggcgtggagatgcccgaggccgatggcgagcgaatcatccgc
ctggtcgcggcccacgtcggcgcggaggtgcatcgcggccagccgctgctatcggccgag
ctgcccgagacgggcgaacgcttcgagggcatcttgccgcccgccgcgccagggccggcc
ttcgcgctgcgcaagcgcgccatcggcgtgatcccgctggagcggtatgtcgtggacgga
atgatgaccgccgcccaggcgggctttctggtgcgcgccgtgcgcgagcgtcagaacgtc
ctgatcgccggggccaccagcagcggcaagaccacgctcgccaatgccttgctcgccgaa
atcgccgccacgggcgaccgcgtgttggtgctcgaagacacggtggagctgcaatgcgcg
gcccgcgaccacgttccgctgcgcacgcgcgcgggcgtggtgtcgatgaccgagctggtg
cgctcgtccatgcggctgcggccggatcgcgtggtggttggcgaggtgcgcggcgccgag
gcgctggatctcatcaaggtgtggggaacgggccaccccggcgggatcgccacgatccat
gccggctccgcgttgggcgcgctgctgcgcatggagcaactgattctcgaagtggcggtg
aacccgccgcgtgcgctgatcgccgaggcggtcaacgtggtgatccacatcgccggacgc
gggcgcaagcgccgcatcgagagcatcgcccgcgtcgtcggctccgacggcgtgggctac
caactggcggacgcgctggagacgccgtttcccgaactgccgctatttcccgaagccgca
cccgctgcggcgacttccccgtcccctgaccaacctggagaactgccatga

DBGET integrated database retrieval system