KEGG   Pan paniscus (bonobo): 100991115
Entry
100991115         CDS       T02283                                 

Gene name
LRRK2
Definition
(RefSeq) leucine rich repeat kinase 2
  KO
K08844  leucine-rich repeat kinase 2 [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100991115 (LRRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991115 (LRRK2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100991115 (LRRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100991115 (LRRK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100991115 (LRRK2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: TKL group
  LRRK family
   100991115 (LRRK2)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100991115 (LRRK2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100991115 (LRRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Roc LRR_8 COR LRR_4 Ras LRR_9 Arf Ank_2 ABC_tran T2SSE AAA_7 AAA_22 MMR_HSR1 Kdo NB-ARC PduV-EutP NACHT Septin TniB G-alpha Gtr1_RagA cobW MobB TrwB_AAD_bind AAA_16 FtsK_SpoIIIE TsaE AAA_29 SRPRB AAA_23 PQQ_2 AAA_33 ResIII LRR_6
Other DBs
NCBI-GeneID: 100991115
NCBI-ProteinID: XP_003825774
UniProt: A0A2R9C3L1
Position
12
AA seq 2527 aa
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNI
HVPLLIVLDSYMRVASVQQVGWSLLCKLIEICPGTMQSLMGPQDVGNDWEVLGVHQLILK
MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPISERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN
DIHKLVLAPLNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSA
SFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG
KGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA
RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
SFLVKRKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISGHLEHLEKLELHQ
NALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTM
KCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISRICSPLRLKELKILNLSKNH
ISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELRLNFDFKHIGCKAKDIIR
FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQI
RDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPAIRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN
QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPK
HPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL
NWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTLPISQIAPDLI
LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD
GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRHILLPKNLTVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQ
SGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTV
KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT
SQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCELIDCVHLLREVTVKE
NKESKHKMSYSGRVKTLCLQKNTALWVGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT
AQLGSLKNVMLVLGYNRKSTEGTQEQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
MRGTSVE
NT seq 7584 nt   +upstreamnt  +downstreamnt
atggctagtggcagctgtcaggggtgcgaggaggacgaggaaactctgaagaagttgata
gtcaggctgaacaatgtccaggaaggaaaacagatagaaacgctggtccaaatcctggag
gatctgctggtgttcacgtactccgagcacgcctccaagttatttcaaggcaaaaatatc
catgtgcctctgttgatcgtcttggactcctatatgagagtcgcgagtgtgcagcaggtg
ggttggtcacttctgtgcaaattaatagaaatctgtccaggtacaatgcaaagcttaatg
ggaccccaggatgttggaaatgattgggaagtccttggtgttcaccaattgattcttaaa
atgctaacagttcataatgccagtgtaaacttgtcagtgattggactgaagaccttagat
ctcctcctaacttcaggtaaaatcaccttgctgatattggatgaagaaagtgatattttc
atgttaatttttgatgccatgcactcatttccagccaatgatgaagtccagaaacttgga
tgcaaagctttacatgtgctgtttgagagagtctcagaggagcaactgactgaatttgtt
gagaacaaagattatatgatattgttaagtgcgttaacaaattttaaagatgaagaggaa
attgtgcttcatgtgctgcattgtttacattccctagcgattccttgcaataatgtggaa
gtcctcatgagtggcaatgtcaggtgttataatattgtggtggaagctatgaaagcattc
cctatcagtgaaagaattcaagaagtgagttgctgtttgctccataggcttacattaggt
aattttttcaatatcctggtattaaatgaagtccatgagtttgtggtgaaagctgtgcag
cagtacccagagaacgcagcattgcagatctcagcgctcagctgtttggccctcctcact
gagactattttcttaaatcaagatttagaggaaaagaatgagaatcaagagaatgatgat
gagggggaagaagataaattgttttggctggaagcctgttacaaagcattaacgtggcat
agaaagaacaagcacgtgcaggaggccgcatgctgggcactaaataatctccttatgtac
caaaacagtttacatgagaagattggagatgaagatggccatttcccagctcatagggaa
gtgatgctctccatgcttatgcattcttcatcaaaggaagttttccaggcatctgcgaat
gcattgtcaactctcttagaacaaaatgttaatttcagaaaaatactgttatcaaaagga
atacacctgaatgttttggagttaatgcagaagcacatacattctcctgaagtggctgaa
agtggctgtaaaatgctaaatcatctttttgaaggaagcaacacttccctggatataatg
gcagcagtggtccccaaaatactaacagttatgaaacgtcatgagacatcattaccagtg
cagctggaggcgcttcgagctattttacattttatagtgcctggcatgccagaagaatcc
agggaggatacagaatttcatcataagctaaatatggttaaaaaacagtgtttcaagaat
gatattcacaaactggtcctagcacctttgaacaggttcattggaaatcctgggattcag
aaatgtggattaaaagtaatttcttctattgtacattttcctgatgcattagagatgtta
tccctggaaggtgctatggattcagtgcttcacacactgcagatgtatccagatgaccaa
gaaattcagtgtctgggtttaagtcttataggatacttgattacaaagaagaatgtgttc
ataggaactggacatctgctggcaaaaattctggtttccagcttataccgatttaaggat
gttgctgaaatacagactaaaggatttcagacaatcttagcaatcctcaaattgtcagca
tctttttctaagctgctggtgcatcattcatttgacttagtaatattccatcaaatgtct
tccaatatcatggaacaaaaggatcaacagtttctaaacctctgttgcaagtgttttgca
aaagtagctatggatgattacttaaaaaatgtgatgctagagagagcgtgtgatcagaat
aacagcatcatggtcgaatgcttgcttctattgggagcagatgccaatcaagcaaaggag
ggatcttctttaatttgtcaggtatgtgagaaagagagcagtcccaaattggtggaactc
ttactgaatagtggatctcgtgaacaagatgtacgaaaagcgctgacgataagcattggg
aaaggtgacagccagatcatcagcttgcttttaaggaggctggctctggatgtggccaac
aatagcatttgccttggaggattttgtataggaaaagttgaaccttcttggctcggtcct
ttatttccagataagacttctaatttaaggaaacaaacaaatatagcatctacactagca
agaatggtgatcagatatcagatgaaaagtgctgtggaagaaggaacagcctcaggcagc
gatggaaatttttctgaagatgtgctgtctaaatttgatgaatggacctttattcctgac
tcttctatggacagtgtgtttgctcaaagtgatgacctggatagtgaaggaagtgaaggc
tcatttcttgtgaaaaggaaatctaattcaattagtgtaggagaattttaccgagatgcc
gtattacagcgttgctcaccaaatttgcaaagacattccaattccttggggcccattttt
gatcatgaagatttactgaagcgaaaaagaaaaatattatcttcagatgattcactcagg
tcatcaaaacttcaatcccatatgaggcattcagacagcatttcttctctggcttctgag
agagaatatattacatcactagacctttcagcaaatgaactaagagatattgatgcccta
agccagaaatgctgtataagtggtcatttggagcatcttgaaaagctggagcttcaccag
aatgcactcacgagctttccacaacagctatgtgaaactctgaagagtttgacacatttg
gacttgcacagtaataaatttacatcatttccttcttacttgttgaaaatgagttgtatt
gctaatcttgatgtctctcgaaatgacattggaccctcagtggttttagatcctacaatg
aaatgtccaactctgaaacagtttaacctgtcatataaccagctgtcttttgtacctgag
aacctcactgatgtggtagagaaactggagcagctcattttagaaggaaataaaatatca
cggatatgctcccccttgagactgaaggaactgaagattttaaaccttagtaagaaccac
atttcatccctatcagagaactttcttgaggcttgtcctaaagtggagagtttcagtgcc
agaatgaattttcttgctgctatgcctttcttgcctccttctatgacaatcctaaaatta
tctcagaacaaattttcctgtattccagaagcaattttaaatcttccacacttgcggtct
ttagatatgagcagcaatgatattcagtacctaccaggtcctgcacactggaaatctttg
aacttaagggaactcttatttagccataatcagatcagcatcttggacttgagtgaaaaa
gcatatttatggtctagagtagagaaactgcatctttctcacaataaactgaaagagatt
cctcctgagattggctgtcttgaaaatctgacatctctggatgtcagttacaacttggag
ctaagatcctttcccaatgaaatggggaaattaagcaaaatatgggatcttcctttggat
gaactgcgtcttaactttgattttaaacatataggatgtaaagccaaagacatcataagg
tttcttcaacagcgattaaaaaaggctgtgccttataaccgaatgaaacttatgattgtg
ggaaatactgggagtggtaaaaccaccttattgcagcaattaatgaaaaccaagaaatca
gatcttggaatgcaaagtgccacagttggcatagatgtgaaagactggcctatccaaata
agagacaaaagaaagagagatctcgtcctaaatgtgtgggattttgcaggtcgtgaggaa
ttctatagtactcatccccattttatgacgcagcgagcattgtaccttgctgtctatgac
ctcagcaagggacaggctgaagttgatgccatgaagccttggctcttcaatataaaggct
cgcgcttcttcttcccctgtgattctcgttggcacacatttggatgtttctgatgagaag
caacgcaaagcctgcataagtaaaatcaccaaggaactcctgaataagcgagggttccct
gccatacgagattaccactttgtgaatgccaccgaggaatctgatgctttggcaaaactt
cggaaaaccatcataaacgagagccttaatttcaagatccgagatcagcttgttgttgga
cagctgattccagactgctatgtagaacttgaaaaaatcattttatcggagcgtaaaaat
gtgccaattgaatttcccgtaattgaccggaaacgattattacaactagtgagagaaaac
cagctgcagttagatgaaaatgagcttcctcacgcagttcactttctaaatgaatcagga
gtccttcttcattttcaagacccagcactgcagttaagtgacttgtactttgtggaaccc
aagtggctttgtaaaatcatggcacagattttgacagtgaaagtggaaggttgtccaaaa
caccctaagggaattatttcgcgtagagatgtggaaaaatttctttcaaagaaaaggaaa
tttccaaagaactacatgtcacagtattttaagctcctagaaaaattccagattgctttg
ccaataggagaagaatatttgctggttccaagcagtttgtctgaccacaggcctgtgata
gagcttccccattgtgagaactctgaaattatcatccgactatatgaaatgccttatttt
ccaatgggattttggtcaagattaatcaatcgattacttgagatttcaccttacatgctt
tcagggagagaacgagcacttcgcccaaacagaatgtattggcgacaaggcatttactta
aattggtctcctgaagcttattgtctggtaggatctgaagtcttagacaatcatccagag
agtttcttaaaaattacagttccttcttgtagaaaaggctgtattcttttgggccaagtt
gtggaccacattgattctctcatggaagaatggtttcctgggttgctggagattgatatt
tgtggtgaaggagaaactctgttgaagaaatgggcattatatagttttaatgatggcgaa
gaacatcaaaaaatcttacttgatgacttgatgaagaaagcagaggaaggagatctctta
gtaaatccagatcaaccaaggctcacccttccaatatctcagattgcccctgacttgatt
ttggctgacctgcctagaaatattatgttgaataatgatgagttggaatttgaacaagct
ccagagtttctcctaggtgatggcagttttggatcggtttatcgagcagcctatgaagga
gaagaagtggctgtgaagatttttaataaacatacatcactcaggctgttaagacaagag
cttgtggtgctttgccacctccaccaccccagtttgatatctttgctggcagctgggatt
cgtccccggatgttggtgatggagttagcctccaagggttccttggatcgcctgcttcag
caggacaaagccagcctcactagaaccctacagcacaggatcgcactccatgtagctgat
ggtttgagatacctccactcagccatgattatataccgagacctgaaaccccacaatgtg
ctgcttttcaccctgtatcccaatgctgccatcattgcaaagattgctgactacggcatt
gctcagtactgctgtagaatggggataaaaacatcagagggcacaccagggtttcgtgca
cctgaagttgccagaggaaatgtcatttataaccaacaggctgatgtttattcatttggt
ttactactctatgacattttgacaactggaggtagaatagtagagggtttgaagtttcca
aatgagtttgatgaattagaaatacaaggaaaattacctgatccagttaaagaatatggt
tgtgccccatggcctatggttgagaaattaattaaacagtgtttgaaagaaaatcctcaa
gaaaggcctacttctgcccaggtctttgacattttgaattcagctgaattagtctgtctg
acgagacacattttattacctaaaaacttaactgttgaatgcatggttgctacacatcac
aacagcaggaatgcaagcatttggctgggctgtgggcacaccgacagaggacagctctca
tttcttgacttaaatactgaaggatacacttctgaggaagttgctgatagtagaatattg
tgcttagccttggtgcatcttcctgttgaaaaggaaagctggattgtgtctgggacacag
tctggtactctcctggtcatcaataccgaagatgggaaaaagagacataccctagaaaag
atgactgattctgtcacttgtttgtattgcaattccttttccaagcaaagcaaacaaaaa
aattttcttttggttggaaccgctgatggcaagttagcaatttttgaagataagactgtt
aagcttaaaggagctgctcctttgaagatactaaatataggaaatgtcagtactccactg
atgtgtttgagtgaatccacaaattcaacggaaagaaatgtaatgtggggaggatgtggc
acaaagattttctccttttctaatgatttcaccattcagaaactcattgagacaagaaca
agccaactgttttcttatgcagctttcagtgattccaacatcataacagtggtggtagac
actgctctctatattgctaagcaaaatagccctgttgtggaagtgtgggataagaaaact
gaaaaactctgtgaactaatagactgcgtgcaccttttaagggaggtaacggtaaaagaa
aacaaggaatcaaaacacaaaatgtcttattctgggagagtgaaaaccctctgccttcag
aagaacactgctctttgggtaggaactggaggaggccatattttactcctggatctttca
actcgtcgacttatacgtgtaatttacaacttttgtaattcggtcagagtcatgatgaca
gcacagctaggaagccttaaaaatgtcatgctggtattgggctacaaccggaaaagtact
gaaggtacacaagagcagaaagagatacaatcttgcttgaccgtttgggacatcaatctt
ccacatgaagtgcaaaatttagaaaaacacattgaagtgagaaaagaattagctgaaaaa
atgagaggaacatctgttgaataa

DBGET integrated database retrieval system