KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1219
Entry
PSTAB_1219        CDS       T01571                                 
Name
(GenBank) hypothetical protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE ATPase_2 T2SSE AIG1 AAA_10 AAA_16 TrwB_AAD_bind DUF4913 AAA_7 DUF87
Other DBs
NCBI-ProteinID: AEJ04500
UniProt: F8H209
Position
1280061..1282949
AA seq 962 aa
MAWSLSWSRKGDASPADAVDATDDAWARHVAALVAQGVAEPGSALGRGRRRPATQADHDA
LYGVAPSFADLLPWVEYLPGSKCMLLEDGQSVAAFFELAPVGTEGREMAWLWQARDALEN
ALQDSFDELDDNPWVVQLYAQDEADWDNYLRSLANYLQPRAQGSAFSDFYLRFFAHHLRA
IAKPGGLFEDTTVTRLPWRGQVRRVRMVVYRRTSAAPASRRGQSPEQALTTICDRLVGGL
ANAGVKARRLGAADIHAWLLRWFNPNPTLLGATAEDRERFYALTRYPEEREEGEIELASG
TDFAQRLFFGQPRSDVPNGLWFFDGMPHRVIVMDRLRTPPVTGHLTGETRKGGDAMNALF
DQMPEDTVMCLTLVATPQDVLEAHLNHLARKAVGETLASEQTRQDVQQARGLIGSAHKLY
RGALAFYLRGRDLAQLDARGLQLVNVMLNAGLQPVREEDEVAPLNSYLRWLPCVFDPAAD
KRQWYTQLMFAQHAANLAPVWGRSQGTGHPGITFFNRGGGPITFDPLNRLDRQMNAHLFL
FGPTGSGKSATLNNILNQVTAIYRPRLFIVEAGNSFGLFGDFAARLGLTVHRVKLSPGAG
VSLAPFADAWRLVDTPSQVQTLDADALDEDQTDAGMAVEGDEQRDVLGELEITARLMITG
GEDKEEARMTRADRSLIRQCILDAAQHCVADERTVLTRDVRDALRERARDATLPEMRRAR
LLEMADAMDMFCQGVDGEMFDRSGTPWPEADITIVDLATFAREGYNAQLSIAYISLINTV
NNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNLDDLPK
AAEPMLNMIEWWICLSMPPDEVEKIARFRELNASQKALMLSARKEAGKFSEGVILSKSME
VLFRAVPPSLYLAMAMTEPEEKAERFQLMQQHGISELDAAFRVAEKIDRARGIEPLALDT
LA
NT seq 2889 nt   +upstreamnt  +downstreamnt
atggcctggtcgctgtcgtggtcacgcaagggcgacgcatcgcctgctgacgccgtggat
gcgaccgatgatgcctgggcacggcacgtggcggccttggtggcacagggtgtcgccgag
ccgggcagcgcgctcggccggggccggcgcaggccggccacccaggccgaccacgatgcg
ctctatggcgtcgcgccgtcgttcgcggacttgctgccctgggtcgagtacctgcccggc
agcaagtgcatgttgctggaagatggccagtcggtggcggccttcttcgagctggcgccg
gtcggcaccgagggccgcgagatggcctggctatggcaggcgcgcgatgcgctggagaac
gccctgcaggactccttcgacgagttggacgacaacccctgggtggtgcagctctacgcc
caggacgaggccgactgggacaactatctgcgctccctggcgaactatctgcagccgcgt
gcgcagggcagtgcgttcagcgacttctacctgcgcttcttcgcccatcatctgcgggcc
atcgccaagccgggtggcttgttcgaggacaccacggtgacgcgcctgccgtggcgcggt
caggtccggcgcgtgcgcatggtggtctaccgccgcacgtccgcggccccggcttcgcgg
cgcggccagtcgcccgagcaggcgctgacgacgatctgcgaccgcctcgtcggcgggctg
gcgaatgccggcgtgaaagcccggcgtctcggcgcggcggacatccacgcctggctgctg
cgctggttcaacccgaatccgactttgctcggcgccactgccgaagatcgggaacgcttc
tacgcgctgacccgctacccggaagagcgggaggagggcgagatcgaactcgccagcggc
accgacttcgcgcagcgcctgttcttcggccagccacgttcggacgtgcccaacggcctg
tggttcttcgacggcatgccgcatcgggtgatcgtgatggatcgcctgcgcacgccaccc
gtgaccggccatctgacgggcgagacgcgcaaaggcggcgatgccatgaacgcgctgttc
gatcagatgcccgaggacacggtgatgtgcctgacgctggtcgccacgccccaggacgtt
ctggaggcgcacctcaaccacctcgccaggaaagccgtcggcgagaccctggcctcggag
cagacccggcaggacgtgcagcaggcgcgcggcctgatcggcagcgcgcacaagctctac
cgcggcgcgctggcgttctacctgcgcggccgcgacctggcccagctcgatgcgcgcggc
ctgcagctcgtcaacgtgatgctcaacgccggtctgcaaccggtgcgcgaagaggacgag
gtggcgccgctgaacagctatctgcgctggctgccgtgcgtgttcgatccggcggccgac
aagcgccagtggtacacccagctcatgttcgcgcagcacgcggcgaacctggcgccggtc
tggggccgcagtcagggcacggggcatccgggcatcacgttcttcaaccgcggcggcggc
ccgatcaccttcgatccgttgaaccgcctcgaccggcagatgaacgcgcatctgttcctg
ttcggccccacgggttcgggcaagagcgcgacgctcaacaacatcctgaatcaggtgacg
gcgatctatcggccgcgcctgttcatcgtcgaggcgggcaacagcttcggcctgttcggc
gacttcgcggcacggctgggcctcaccgtgcatcgggtgaagctctcgccgggcgcgggc
gtcagtctggcgccgttcgccgacgcctggcgcctggtcgatacgccgagccaggtacag
acgctggacgccgatgcgctcgacgaagaccagaccgatgccggcatggccgtggaaggc
gacgagcagcgcgacgtgctcggcgagctggaaatcactgcacgactgatgatcaccggc
ggcgaggacaaggaagaagcgcgcatgacccgcgccgaccgcagcctgatccgccagtgc
attctcgatgcggcacagcattgcgtggcggacgaacgcacggtgctcacacgcgatgtg
cgcgacgcgctgcgcgagcgcgcccgcgacgccacgctgccggagatgcggcgcgcacgg
ctgctggagatggccgacgccatggatatgttctgccagggcgtggacggcgagatgttc
gaccggtccggcacgccgtggcccgaggcggacatcaccatcgtggacctggccaccttc
gcgcgcgagggctacaacgcccaactctcgattgcctacatctcgctcatcaacacggtc
aacaacatcgccgagcgcgaccagttcctgggccgcccgatcatcaacgtgacggacgaa
ggccacatcatcacgaagaacccgctgctcgcgccctacgtggtcaagatcaccaagatg
tggcgcaagctcggcgcctggttctggctcgccacgcagaacctggacgacctgccgaaa
gcggccgagcccatgctcaacatgatcgagtggtggatctgcctgtcgatgccacccgat
gaagtcgagaagatcgcgcgcttccgcgaactcaacgcttcgcagaaggcgctgatgctc
tcggcacgcaaggaggccggcaagttcagcgagggcgtcatcctgtccaagtcgatggaa
gtgctgttccgcgccgtgccgcccagcctctacctggcgatggcgatgaccgagcccgag
gagaaggccgaacgcttccagttgatgcagcagcacggcatcagcgagctggatgccgcc
ttccgcgtggccgagaagatcgaccgtgcgcggggcatcgaaccgctggcgctggatacg
ttggcctga

DBGET integrated database retrieval system