KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000900Help
Entry
RHECIAT_PC0000900 CDS       T00720                                 

Gene name
virB11c
Definition
(GenBank) transport secretion system IV protein, VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RHECIAT_PC0000900 (virB11c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rec02044]
    RHECIAT_PC0000900 (virB11c)
Enzymes [BR:rec01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RHECIAT_PC0000900 (virB11c)
Secretion system [BR:rec02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RHECIAT_PC0000900 (virB11c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE ResIII ABC_tran AAA_18 Zeta_toxin FtsK_SpoIIIE DEAD AAA_16 AAA_7 Guanylate_kin AAA_28 AAA_22 TsaE Mg_chelatase TrwB_AAD_bind AAA_29 AAA_14 AAA_23 Myosin_head PduV-EutP CbiA AAA_19 RNA_helicase NACHT AAA_21 AAA_33 IstB_IS21 cobW Sigma54_activat Viral_helicase1 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ACE94970
UniProt: B3Q3W0
Position
pC:complement(990864..991859)
Genome map
AA seq 331 aa AA seqDB search
MTEAPDSAVVRELLSPLSPFLRDKTFYEVIVNRPGQVVTEGGEGWQTYDMAELSYDRLMR
LARAVASFSNQSIDETRPILSATLPDGERIQIVIPPATTKGTVSITIRKPSSVSLTLEDL
DHGGLFADVALAEGDGGRWDKSLLDYYRVGAYKAFLREAVFARKNIIISGATGSGKTTLS
KALIRYIPQSERIISIEDTPELVVPQPNHVRLFYSKGGQGLAKVGAKDLLESCLRMRPDR
ILLQELRDGTAFYYIRNINSGHPGSITTVHADSTRLAFEQLTLLVKESEGGGDLERHDIR
EMLTIAVDIIVQCKRIDGRFRVSEIYYRDAE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagctccggactccgcagtcgtgcgcgaattgctttcgcctctctcgccgttc
cttcgcgacaagacgttctatgaggtcatcgtcaatcgacccgggcaagtcgtcacggag
ggcggggagggatggcagacctacgacatggcggaactatcctacgacaggctgatgcgt
ctcgcgcgggcggtcgcgagtttttccaatcaatcgatcgacgagacacggccgatcctg
tcggcgaccttgccggatggcgagcggatccagatcgtcattccgccggcaacgacgaag
ggaaccgtcagcatcaccatacgcaagccatcctccgtgtcgctgaccctcgaggatctc
gaccatggaggattgttcgccgatgtcgcgctggccgaaggcgacggagggcgatgggac
aaaagcctgttggattactatcgggtcggcgcctataaggcgtttctccgggaggcggtg
tttgcaagaaagaacatcatcatttccggcgccacgggctctggaaagaccaccctgtcg
aaagcgctgatccgttatattccgcaaagcgagcggatcatttcgatcgaagacacaccg
gagctggtggtcccgcagcccaatcacgttcggctcttttattccaagggcgggcagggg
ctcgccaaagtcggcgccaaggacctgctcgaatcctgtctgcgcatgcggcccgaccgc
atcctgctgcaggagctgcgagacggcacggctttctactacattcgcaacatcaactcc
ggccatccgggctcgatcacgacggttcacgccgattccacccggctcgccttcgagcaa
ctgacattgctggtcaaggagtcggaaggcggcggggacctcgagcggcacgacatccgc
gagatgctgacgattgctgtcgatatcattgttcaatgcaagcggattgatggccgcttt
cgggtaagcgagatctactatcgagatgccgaatga

DBGET integrated database retrieval system