KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6502
Entry
Reut_D6502        CDS       T00268                                 

Definition
(GenBank) type II secretion system protein E
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:reu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Reut_D6502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reu02044]
    Reut_D6502
Enzymes [BR:reu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Reut_D6502
Secretion system [BR:reu02044]
 Type IV secretion system
  Trb secretion system protein
   Reut_D6502
SSDB
Motif
Pfam: T2SSE FtsK_SpoIIIE AAA_19 DUF87 AAA_29 DEAD AAA_16 PduV-EutP TrwB_AAD_bind ABC_tran AAA_30 AAA_7 ResIII Septin TsaE P-loop_TraG GTP_EFTU AAA_10 NACHT RsgA_GTPase MMR_HSR1 Mg_chelatase AAA_22 AAA IstB_IS21 cobW UvrD-helicase ATPase_2 Zeta_toxin AAA_23 Bac_DnaA Pox_A32 Dynamin_N AAA_28 Sigma54_activat PhoH DUF815 AIG1 Adeno_IVa2 ATP_bind_1 AAA_11 RuvB_N DUF2075 Roc RNA_helicase AAA_2 AAA_24
Other DBs
NCBI-ProteinID: AAZ65800
UniProt: Q6UP63
Position
p1:58243..59205
AA seq 320 aa
MTDQKPEHNSIKERAKKKLERDMGPELLAALNDPKTVEIMLNADGKLWLERLGEPMKCIG
TLRVAQAQAIIETIAGYHGKEVTRSKPILEGELPLDGSRFAGQLPPVVPAPTFAIRKKAV
AIFTLDQYVERGIMTAPQREALIAAVRAHRNILVIGGTGSGKTTLVNAIINEMVIQDPTE
RVFIIEDTGEIQCAAENYVQYHTSIDVNMTALLKTTLRMRPDRILVGEVRGPEALDLLMA
WNTGHEGGAATLHANNAKAGLDRLAMLISMHPDSPKPIEPLIGEAVHVVVHIARVEGSRR
IQEILEVSGFANGQYITKTL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaccgaccagaaaccagaacacaacagcatcaaggaacgggcgaagaagaagctcgaa
cgcgacatggggccggagctgctggccgccctcaacgatcccaagaccgttgaaatcatg
ctcaacgcggacggcaagctctggctcgaacgcctgggcgagccgatgaagtgcatcggc
acgctgcgcgtcgcgcaggcgcaagccatcatcgaaaccatcgcgggctaccacggcaag
gaagtcacgcgctccaagccgatcctggaaggcgagctgccccttgatggcagtcgcttc
gccggccagctcccgccggttgtgcccgcacccaccttcgccattcggaagaaggccgtc
gccatcttcacgctcgatcagtacgtcgaacgcggaatcatgaccgcgccgcagcgcgag
gcattgattgcagcggtgcgcgcgcaccggaacatccttgtgatcggcggcaccggctcg
ggcaagaccacgctggtgaacgcgatcatcaacgagatggtgattcaagacccgaccgag
cgggttttcatcatcgaggacaccggcgaaatccagtgcgccgccgagaactacgtccag
taccacaccagcatcgacgtgaacatgacggcgctgctgaaaaccaccctccgcatgcgc
cccgaccgaatcctggtcggcgaggtgcgcggccccgaagcccttgatctgttgatggcc
tggaacaccgggcacgaaggaggtgctgcaaccctgcacgcaaacaacgccaaagctgga
ttggatcggctcgccatgctcatcagcatgcaccccgattccccgaaacccattgaaccg
cttatcggcgaggcggttcacgtggttgttcatatcgcccgcgtcgaaggctcgcggcgc
atccaggaaatcttggaggtttccgggttcgccaacggccagtacatcaccaaaaccctc
tga

DBGET integrated database retrieval system